Conserved Protein Domain Family
VSP

?
pfam03302: VSP 
Giardia variant-specific surface protein
Statistics
?
PSSM-Id: 146106
View PSSM: pfam03302
Aligned: 6 rows
Threshold Bit Score: 346.572
Threshold Setting Gi: 74765999
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q03185 265 CEGCDSGFIL--DGQNCVKSD---CKTENCKACTNPKAanEVCTECISTHHLTP-TSQCVQYCQALGNYYAGTNAdNKKA 338 Giardia intestinalis
P21849 315 CSACTDGYKPsaDKTTCEAVSn--CKTPGCKACSNEGKenEVCTDCDGSTYLTP-TSQCIDSCAKIGNYYGATEG-AKKL 390 Giardia intestinalis
Q9U048 309 CIACTNGYKPsaDKTTCEAVSn--CKTPGCKACSNEGKenEVCTDCDSSTYLTP-TSQCIDSCAKIGNYYGATEG-AKKI 384 Giardia intestinalis
Q24990   4 PALCFLMSGLaaQRTKQPTSG---CQVDNCERCVPSDE--TKCEACNSGFDLDEnTKQCNPAPAECPIVNCQTCSqDKQT 78  Giardia intestinalis
Q9U019 321 CDECKPGYEIstDKTKCTSTAppdCPIENCKVCSEDKR---ACEECNSNNYLTP-TRMCIDDCKKIGNYYYTTNAnNKLI 396 Giardia intestinalis
Q9U021 321 CDECKPGYEIstDKTKCTSTAppdCPIENCKVCSEDKR---ACEECNSNNYLTP-TRMCIDDCKKIGNYYYTSNAnNKLI 396 Giardia intestinalis
Q03185 339 CKECTVANCKTCNDQGQCQTCNDGFYKNGDACSPCHESCKTCSAGTASDCTECPTGKALKYGNDGTKGTCGEGCTTGQGS 418 Giardia intestinalis
P21849 391 CKECTAANCKTCDDQGQCQACNDGFYKNGDACSPCHESCKTCSAGTASDCTECPTGKALRYGDDGTKGTCGEGCTTGTGA 470 Giardia intestinalis
Q9U048 385 CKECTAANCKTCDGQGQCQACSDGFYKNGDACSPCHESCKTCSAGTASDCTECPTGKALRYGDDGTKGTCGEGCTTGQGS 464 Giardia intestinalis
Q24990  79 CVACEPGKHLTPTKKACLDACPVGTYLSGQTCAPATPPVRSAAGPALSKCTACLAGKMLRY-TDETKLNEGGQCVEQCVE 157 Giardia intestinalis
Q9U019 397 CKECAVANCKECENTGTCKTCDDGFYKSSEECKACDSNCKTCNGGTSADCTKCLSGAVLKYGNDGTKGTCGAGCATGTGA 476 Giardia intestinalis
Q9U021 397 CKECAVANCKECENTGTCKTCDDGFYKSSEECKACDSNCKTCNGGTSADCTKCLSGAVLKYGNDGTKGTCGAGCATGTGA 476 Giardia intestinalis
Q03185 419 G-ACKTCGLTIDGASYCSECDTQNEYPQNGICTSTTARTVATCKNSNVANGICSSCTNGFLRMNGGCYETTKFPGKSVCE 497 Giardia intestinalis
P21849 471 G-ACKTCGLTIDGASYCSECATTTEYPQNGVCAPKASRATPTCNDSPIQNGVCGTCADNYFKMNGGCYETVKYPGKTVCI 549 Giardia intestinalis
Q9U048 465 G-ACKTCGLTIDGASYCSECATTTEYPQNGVCAPKASRATPTCNDSPIQNGVCGTCADNYFKMNGGCYETVKYPGKTVCI 543 Giardia intestinalis
Q24990 158 GpECETCGLTIGGTKYCSKCKGS-NVPLNGVCTSNAAR-TQFCT--TAADGRCSACAAGYFIQEGGCYQTTRLPGKSICT 233 Giardia intestinalis
Q9U019 477 G-ACKTCGLIIDGTSYCSECAVETEYPQGGVCSSTTVRAAATCKAGSVAKGMCNSCTNGFLRMNGGCYETTKFPGKSVCE 555 Giardia intestinalis
Q9U021 477 G-ACKTCGLIIDGTSYCSECAVETEYPQGGVCSSTTVRAAATCKAGSVAKGMCNSCTNGFLRMNGGCYETTKFPGKSVCE 555 Giardia intestinalis
Q03185 498 GANADAdTCKAPVPGYKVEAGKLVMCSKGCDTCSDATTCTKCGDGYTKIenSQTCTKCDSSCETCT-GAATTCKVCATGY 576 Giardia intestinalis
P21849 550 SAPNGG-TCQKAADGYKLDSGTLTVCSEGCKECASSTDCTTCLDGYVKS--ASACTKCDASCETCN-GAATTCKACATGY 625 Giardia intestinalis
Q9U048 544 SAPNGG-TCQKAADGYKLDSGTLTVCSEGCKECTSSTDCTTCLDGYVKS--ASACTKCDSSCETCN-GAATTCKACATGY 619 Giardia intestinalis
Q24990 234 TDNGGK--------------------------------CQTCANGQTPDggTGVCPLCDSTCKTCTaGQTQQCQTCFSGY 281 Giardia intestinalis
Q9U019 556 EAASAGdTCQKEAPGYHLNNNDLVTCSPGCKTCTSNTVCTACMEGYVKT--SDSCAKCAAGCATCT-GSTTACDTCSTGY 632 Giardia intestinalis
Q9U021 556 EAASAGdTCQKEAPGYHLNNNDLVTCSPGCKTCTSNTVCTACMEGYVKT--SDSCAKCAAGCATCT-GSTTACDTCSTGY 632 Giardia intestinalis
Q03185 577 YKTALGESTCTSCENDsNGVIGVKGCLNCAPPSSSTGSVLCYLMKGEntgG-SVNKSGLSTGAIAGISVAAVVVVAGLVG 655 Giardia intestinalis
P21849 626 YKTASGEGACTSCESDsNGVTGIKGCLNCAPPPNNKGSVLCYLIKDS---G-STNKSGLSTGAIAGISVAVIVVVGGLIG 701 Giardia intestinalis
Q9U048 620 YKTASGEGACTSCESDsNGVTGIKGCLNCAPPSSSTGSVLCYLIQN-------TNKSGLSAGAIAGISVAVIVVVAGLVG 692 Giardia intestinalis
Q24990 282 YKSGTKCVKCDASDGQ---ITGVTDCVSCAPPSGDSGSVTCYVKMDGssgGnSTNKSGLSTGAIAGIAVAAVIVVGGLVG 358 Giardia intestinalis
Q9U019 633 YESGTTCVSCTESNSD-KTITGVANCASCAPPLNNKGSVLCYLIKDS---G-STNKSGLSTGAIAGIAVAVVIVVGGLVG 707 Giardia intestinalis
Q9U021 633 YKSGTTCVSCTESNSD-KTITGVANCAXCAPPLNNKGSVLCYLIKDS---G-STNKSGLSAGAIAGISVAVIIVVGGLVG 707 Giardia intestinalis
Q03185 656 FLCWWFICRGKA 667 Giardia intestinalis
P21849 702 FLCWWFLCRGKA 713 Giardia intestinalis
Q9U048 693 FLCWWFICRGKA 704 Giardia intestinalis
Q24990 359 FLCWWFICRGKA 370 Giardia intestinalis
Q9U019 708 FLCWWFICRGKA 719 Giardia intestinalis
Q9U021 708 FLCWWFMCRGKA 719 Giardia intestinalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap