Conserved Protein Domain Family
TF_AP-2

?
pfam03299: TF_AP-2 
Transcription factor AP-2
Statistics
?
PSSM-Id: 397406
Aligned: 30 rows
Threshold Bit Score: 210.171
Threshold Setting Gi: 1253278041
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EKC17966     213 FCLVDGRLSLLSSTSKYKVTVAEIQRRLGAPECLNASLLGGVLRRAKSKDGGKNLREKLDKIGLALPAGRRKSAPVTLMT 292 Pacific oyster
XP_002648039  52 FEEVFGKLSNHLDPILYKVTTEEMRRRLFGQEHFNSSSLALNLRRAKSRAGGEILRRELEQKGISLNVNHRKMETPKLVC 131 Caenorhabditis ...
EFO91152      27 FETIVARNSMGEVFNCYHITTAEVDRRSNGVERLNSSSLATTLRRTKQKNGGETMRRQMKEKGIPVNLYHRQEVFPNKFI 106 Caenorhabditis ...
Q9U1W4       147 FDVVHGRLSMGQNQTCYFVTVEEMRRRLQSPEKLNSSSIACNLKRPKLKNGGELMRAQLRDHGIKVQLNAKQKAFPNKVI 226 Caenorhabditis ...
1_pfamImport   1 FELVKGRLVAGENFKKYFVTVEEIRRRIEGYEKLTSTNVANNLRRPKVKNGYELMRAQLAERGIQCKVNKRQNVYATKMI 80 
EFP03341      38 FSLVQGRTSTSHKPVFYHVTTDEVNRRINGIEKLNSSSMACNLKKSKVKNGGEILRKKLEERGVEVNLNKRQNVTPNTII 117 Caenorhabditis ...
XP_003105784  87 FSLVAGRTSTSHTPVFYNVTTSEVDRRINGIEKLNSSSLACTLKKSKVRNGGEILRKKLEGRGVDLVLNTRQNASPNSII 166 Caenorhabditis ...
3_pfamImport   1 LDKVEGRLPIVLDMTRYDLTAEEMRRRISAPEFLNLSALFIFFRKCKKKDGTQEVKDLLKKCELRIEK-TRAHLPISVFT 79 
CAP22074     227 VQEVDGRLPIVGSRSKMSLTVGELRRRVGAPENMNMSAMYAYFRKSKKKETMQQVKEILERHQIDIPHMQRKRK-FSRFT 305 Caenorhabditis ...
Q19863       232 AEVVDGRLPAVGTRSKYDLTVDELRRRCGAPEHMNQSALYCFFRKSKKKEAINRVKKVLTDYNITVRTMQRQRK-VTCFS 310 Caenorhabditis ...
EKC17966     293 SLVEGEAIRMARDFGFLCETEFPSRQCAKHNVNKYQsnVPE-EQMARKNMIVASKQILKEFMDILNQDRSPiGNSR-PQP 370 Pacific oyster
XP_002648039 132 SLVEGEVIHMAKDMEDIVDEQYDCDLIAQEVVDEMKe-NEKlDFE-------GFETCMSSLSTVFSSVVPP-LSGMsSKS 202 Caenorhabditis ...
EFO91152     107 ALSEAETVHMAKDLEKIVKDDYPVKELAREVANEVMe-DGSvDIEQFFDA-DGFKECMEALGEVLSAVVPP-ITGIcAKA 183 Caenorhabditis ...
Q9U1W4       227 ALVEAEAVHLGLDLGTAVRDDYPVQDIIQEVAHEALa-DEDaDLDALMND-KDFTECMSALESVFTSVVPP-ITGIePKP 303 Caenorhabditis ...
1_pfamImport  81 ALSESEVKEFITDMSAACSD-YPVSKIAGEILDHHIncDVNsVISLGYSS-DDFVNVMSSLRSIFNSVLPP-LTGIkSFA 157
EFP03341     118 PLTEAEAVHFGKDLGKSIDEAYPRDELAEEFASEALs-NDSaQLESLVEL-DAFRECMASLKNVFSSVVPP-CTGLrPKA 194 Caenorhabditis ...
XP_003105784 167 SLTEAEAVHFGKDLDEAIDNGYPQAELAEEFAREALs-QENvKLESLLNT-EAFMECMSSLNNIISSVVPP-CTGLrPKA 243 Caenorhabditis ...
3_pfamImport  80 FTFEAEMLAFAKQIDLLYNSTFPHEILAWKLLEDMT--DSGfTLNICLKKLESSHNALVTLVSIYEEIQPK--VVGlEEK 155
CAP22074     306 PMLEEECSRLAEDLSKLYEKYLPEATLAEQMVMDML--GKGcTLDKCLRFLENTKKIMGKIVNTLESRQPA--LTYhEEK 381 Caenorhabditis ...
Q19863       311 PFLEEEATALARDLDSITEEFLPIDAIALEMLEKLI--FNNkNLDICLRILKNTNKTITRVIKTLEVRQPK--ITGqKEK 386 Caenorhabditis ...
EKC17966     371 VLDQDVQHPLTRFSLISHGFGSPAIVASLATVQTYLTEM 409 Pacific oyster
XP_002648039 203 SENRKFNHQMEAFSNVTHGFGIVSQPTWIRQMTKIGEKM 241 Caenorhabditis briggsae
EFO91152     184 SKNEELNLGMENFSQATHGLGIVIQPTWMRALTEIGEGI 222 Caenorhabditis remanei
Q9U1W4       304 SNNMRLNNGMETFSSASHGLGIVSQRVWLPQLTAIGNGV 342 Caenorhabditis elegans
1_pfamImport 158 SNDRLFNHAMETFSEATHGFGILSQRFWLNQLVEIAEAM 196
EFP03341     195 SNNVDLNLDMERFSQATHGMGIITNHLWLQELTTLGTDM 233 Caenorhabditis remanei
XP_003105784 244 SNNLSLNLGMEEFSQATHGMGIMTNHLWLRELTTLGTDM 282 Caenorhabditis remanei
3_pfamImport 156 YRGCALDEKFAELSLATHGFLHPHSISSFQHVCKVLEIA 194
CAP22074     382 LKNNRLDVFYHVFSLLTHGFGHPVSILHYRHYHKIVVSA 420 Caenorhabditis briggsae
Q19863       387 LKGNSLDLSYHNFSLTTHGFGHPNSLSHYRSYQKIVEQA 425 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap