6AZ1,5XXU


Conserved Protein Domain Family
Ribosomal_S25

?
pfam03297: Ribosomal_S25 
S25 ribosomal protein
Statistics
?
PSSM-Id: 397404
Aligned: 69 rows
Threshold Bit Score: 51.4708
Threshold Setting Gi: 300701189
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6AZ1_AA         4 KAGQTKKAKMEAA-NKGA-KKT-TKKWSKGQSREALQNAVMFDKETYDKLRSEVPKYKLITPSIISDRLKIAVSIAAAGL 80 
EIJ89167        6 VDPKAQQKKDKAP------KKVeAKKWTKTESKAKQLKTSVITQDIFNKIKKEVLNMSLITPATIAARNNFEVALAKNIL 79  Nematocida par...
Q8STD9          1 MVKKIQESKEKKAlKAASgTRKdKKKWGDGRKKEEVRRAVTVSEELLAKVRKDVGRASVVTRYMIGSRYNLNLGVAENVL 80  Encephalitozoo...
XP_002994944    1 MAKKVQETKEKKAlKAAStSKKeKKKWTEIKKKDEARKIFTVSDELLQKVEKEVKKAKIVTVFSLGSKMNLTLSVAKNLL 80  Nosema ceranae...
EPR80056        1 mAKKVLESKTSKAeKISN-STKsKKKWSSGKVAEAVKRHERVEDDIFNKIVKDVKNMRILTRTTLSERYNLSLNISIKLL 79  Spraguea lophi...
ELQ74819       24 MAKKAPESKASKEaKIAKsSSKeKKKWTTGKTKDEVSRQACVDPELLGKIVKDVPNMKMITRSTLVEKYNINLYSSIRVL 103 Trachipleistop...
Q97ZZ6         12 mEKRLKKEAEKQQ------KAEeKKKGPSKTGKEIISRAVTIDEETKKKVLDEIKKESIITPYALATKSGISISVARKIL 85  Saccharolobus ...
jgi:Msed_2234  12 IEKRIKKEAEAQQ------KKEkKK--VSKTGNEVISKNITISDEMIKRVQEEIKKEKIITPYTLATKANITLSVAKRIL 83  Metallosphaera...
jgi:Vdis_0823   9 lsQLAKRQEKQQQqAQAKpAAKgKRAVAEERPTVKAS---LIDQKLLSDVEKEVIKWEYVTPYLVATRFNTKISVAYQIL 85  Vulcanisaeta d...
CCC80854        9 LSQLAKKAEKAGQqQQQA-QAKgKKKEEGGAKKQQI----TAEERLLEALSKEIQTVNAITAYDVASKYGVKMTVALRAL 83  Thermoproteus ...
6AZ1_AA        81 KQLCREKLIRLVSCSSKTRVYTR 103
EIJ89167       80 DQIVESGEIEIIAKSSFGRIYGK 102 Nematocida parisii ERTm3
Q8STD9         81 RHLSNEGVVQQVLGNRRMTIYAg 103 Encephalitozoon cuniculi GB-M1
XP_002994944   81 RHCVNNGIISLIHKSSKTTIYg- 102 Nosema ceranae BRL01
EPR80056       80 RFLEENQIIKLISSHRGSKIYAg 102 Spraguea lophii 42_110
ELQ74819      104 RWLCENEIVGCVSAGRRLKVYCg 126 Trachipleistophora hominis
Q97ZZ6         86 KELENQNVVKLYSKNRRLEIYIa 108 Saccharolobus solfataricus P2
jgi:Msed_2234  84 KDLNEQGTIKEAFRNRRTAIYVa 106 Metallosphaera sedula DSM 5348
jgi:Vdis_0823  86 RALASKGTLVLVSKGHRTEVYTT 108 Vulcanisaeta distributa DSM 14429
CCC80854       84 RTLRAKGDLVLVSKGHRTEVYAp 106 Thermoproteus tenax Kra 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap