6RFL


Conserved Protein Domain Family
Pox_RNA_pol

?
pfam03293: Pox_RNA_pol 
Poxvirus DNA-directed RNA polymerase, 18 kD subunit
Statistics
?
PSSM-Id: 397402
Aligned: 10 rows
Threshold Bit Score: 261.581
Threshold Setting Gi: 123802125
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6RFL_G   1 MSSFVTNGYLSVTLEPHELTLDIKTNIRNAVYKTYLHREISGKMAKKIEIREDVELPLGEIVNNSVVINVPCVITYAYYH 80 
P21967   1 MSLFNTNAYLPVVIQPHELNLDLMDNIKKAVINKYLHKETSGFMAKKIQIVEDTPMPLAELVNNEIVVHVTCNIDYKYYK 80  Fowlpox virus strain ...
Q98264   1 MSTFTRKVYMPVTLEPHELGLEVREHLRAAVMRRYLHKESTGIMPKEIRVCEDVALPLGEIVNNQVVVRVPCQVTYKYYR 80  Molluscum contagiosum...
Q6TVQ0   1 MSTFRQTVYLAVTLQPHELTLDFRGNVAEAVMREYLYKEKGGLMATDIEVCLGNEMPLGRIVNNAVVVSVPCNVTFKYYR 80  Orf virus
P33058   1 MSSFVTNGYLPVTLEPHELTLDIKTNIRNAVYKTYLHKEISGKMAKKIEICKDVELPLGEIVNNSVVINVPCVITYAYYH 80  Variola virus human/I...
Q6TUT1   1 MSTFTKKVYLPITLNPHELTLDLKQNIKDAVIKSYLHRESGGVMAKKIDICFENELPLGEIINNHVVIKVPCLVTYKYYK 80  Yaba monkey tumor virus
Q08FQ8   1 MSTFVRKVYLPISLNPHELTLDIRDNIKDSIYNEYLHKESGGMMAKKIEICFDKELPLGEIINNNVVVKVPCIVTYKFYK 80  Deerpox virus W-848-83
Q8V3L3   1 MSTFTRNVYLPVCLHPHELTLDIHKNIEDAVYREYLHRESGGIMAKKIDICYDKELPLGELINNHILVKVPCIVLYKYYK 80  Swinepox virus
Q9Q8L8   1 MSTFVKHVYLPIMLQPHELTLDVRKNIRDAVYKEYLHRESGGIMAKKIEICYDKELPLGELVNNHVVVKVPCIVTYKYYK 80  Myxoma virus
Q070D6   1 MSSFSQKLFLDVELDPGELNLDVRQNIRRKVMREYLHKERAGIMCTKIEILEEYRLPLGRITNNVITVMVPCLATYKYYR 80  Crocodilepox virus
6RFL_G  81 VGDIVRGTLNIEDESNVTIQCGDLICKLSRDSGTVSFSDSKYCFFRNGNAYDNGSEVTAVLMEAQQGIESSFVFLANIVD 160
P21967  81 VGDIVSGILTITDESDISVVCSDLICKIRSDSGTVSYDNSKYCFIKNGKVYANESTVTVMLKEAQSGMESSFVFLGNIIE 160 Fowlpox virus strain ...
Q98264  81 VGDTVRGTLHITDESDISVACGDLLCRLRRDSGTVSFNDGKYCFMRNGQVYEDGSEVTVTLKEAQTGTESMFVFLASI-S 159 Molluscum contagiosum...
Q6TVQ0  81 VGDTVSGTLNVEDETNVFVDCGDLICQLGKSSGGVTFNESKYCLVRNGVVYEHGSRVSAVLREARSGRESAFVFSAVLLD 160 Orf virus
P33058  81 VGDIVRGTLNIEDESNVTIQCGDLICKLSRDSGTVSFSDSKYCFFRNGNAYDNGSEVSAVLMEAQQGTESSFVFLANIVD 160 Variola virus human/I...
Q6TUT1  81 NGDVVRGTLNIENESNVTISCGDLICKLSRDSGTVSFSDSKYCFIRNGIAYDNGKEVSAVLKEEQQGTESNFVFLASILD 160 Yaba monkey tumor virus
Q08FQ8  81 NGDIVSGTLNIEDESNITVQCGDLICKLNRDSGNVSFSDSKYCFIRNGVAYDNGAQISVVLKEEQQGMNSNFVFLASIID 160 Deerpox virus W-848-83
Q8V3L3  81 NGDIVSGTLNIEDESNITVLCGDLICKLTRESGNISFNNNKYCLIRNGTIYDNGSQISVVLKEEQQGMNSNFVFLASIVD 160 Swinepox virus
Q9Q8L8  81 NGDVVQGTLNIENESNITVQCNDLICKLSRDAGTVSFNDSKYCFIRNGIVYCNGDSVSVTLKEEQQGMNSNFVFLATIVD 160 Myxoma virus
Q070D6  81 IGDVVEGTMEINSESDIAVNCPDLVCHINKDDGTVSFADSKYCFTKDRHVYNAGDTVTVTLKEANSSSGSSKFSFTGVIN 160 Crocodilepox virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap