5XEA


Conserved Protein Domain Family
Baculo_gp64

?
pfam03273: Baculo_gp64 
Click on image for an interactive view with Cn3D
Baculovirus gp64 envelope glycoprotein family
This family includes the gp64 glycoprotein from baculovirus as well as other viruses.
Statistics
?
PSSM-Id: 397395
Aligned: 2 rows
Threshold Bit Score: 873.739
Threshold Setting Gi: 81947704
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5XEA_C   1 D-CNTKTATGPYI---LDRYKPK-------PVTVSKKLYsatryttsaqNELLTAGYRTAWVAYCYNGGLVDSNTGCNAR 69  Thogoto virus (isolat...
Q8B9D4  39 EhCNAQMKTGPYKiknLDITPPKetlqkdvEITIVETDY----------NENVIIGYKGYYQAYAYNGGSLDPNTRVEET 108 Rachiplusia ou MNPV
5XEA_C  70 LLHYPPSRDELLLWGSSHQCSYGDICHDCWGSDSYACLGQLDPAKHWAPRKELVRRDANWKFAYHMCNIDWRCGVTTSPV 149 Thogoto virus (isolat...
Q8B9D4 109 IKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVKGKELVKRQNNNHFAHHTCNKSWRCGISTSKM 188 Rachiplusia ou MNPV
5XEA_C 150 FFNL--QWVKNEVKVSTLLPNGS-------TVEHSAGeplfwtekdFSYLVKDNFEIQREEVKISCFVDPDywvgerktk 220 Thogoto virus (isolat...
Q8B9D4 189 YSRLecQDDTDECQVYILDAEGNpinvtvdTVLHRDG---------VSMILKQKSTFTTRQIKAACLLIKD--------- 250 Rachiplusia ou MNPV
5XEA_C 221 kafcqDGTNFFEVTSHQFCHQYACYNFSKDEL---LEAVYKERAHEKSKDLPfgnKSW---------TVVTASIDDLHAL 288 Thogoto virus (isolat...
Q8B9D4 251 -----DKNNPDSITREHCLIDNDIYDLSKNTWnckFNRCIKRKVEHRVKKRP---PTWrhnvrakytEGDTATKGDLMHI 322 Rachiplusia ou MNPV
5XEA_C 289 SAAQAFELEGLRASFAELDSRFRQLSEILDTVISSIAKIDERLIGRLIKAPVSSRFISEDKFLLHQCVDSVANNTNCVGD 368 Thogoto virus (isolat...
Q8B9D4 323 QEELMYENDLLKMNIELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTSNCYNN 402 Rachiplusia ou MNPV
5XEA_C 369 SAYVDGRWTHVGDNHPCttvvdepigIDIYNFSAL--------WYPSAAEVDFRGTVQSEDGWSFVVKSKDALIQTMMYT 440 Thogoto virus (isolat...
Q8B9D4 403 SIYKEGRWVANTDSSQC---------IDFSNYKELaidddvefWIPTIGNTTYHDSWKDASGWSFIAQQKSNLITTMENT 473 Rachiplusia ou MNPV
5XEA_C 441 KNGGKGTSLTDLLDYPSGWLKGQLGG 466 Thogoto virus (isolate SiAr 126)
Q8B9D4 474 KFGGVGTSLSDITSMAEGELAAKLTS 499 Rachiplusia ou MNPV
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap