Conserved Protein Domain Family
Cytochrom_NNT

?
pfam03264: Cytochrom_NNT 
NapC/NirT cytochrome c family, N-terminal region
Within the NapC/NirT family of cytochrome c proteins, some members, such as NapC and NirT, bind four haem groups, while others, such as TorC, bind five haems. This family aligns the common N-terminal region that contains four haem-binding C-X(2)-CH motifs.
Statistics
?
PSSM-Id: 397389
Aligned: 63 rows
Threshold Bit Score: 167.442
Threshold Setting Gi: 499450622
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011761577    8 KPSAKYSIFALLlVGVVVGVVGYFATQTTLHMTSTDEFCMSCHSNHSLKDEVLASAHGNN-KNGIVVQCQQCHIAQ--EP 84  Shewanella ama...
Q65V16          1 MSKRKKISMWAAaVLLVIGALLLLGSQYVMKATSSTEFCVSCHSMEYPAEEWKASGHFSN-TKGIRAECADCHIPH--DG 77  [Mannheimia] s...
jgi:HSM_1276    1 makSNKKWLFSGiVGVLLGVIILAGVQYAMKATSTTEFCVSCHSMQQPQAEWEASIHFSN-RKGIRAECADCHIPQ--DN 77  Histophilus so...
Q7VLN0          1 M-SKVKLSLVSGvICAAIGAVALLGTQAVLKSTNSTEFCVSCHSMTHPQAEWEGSVHFSN-RKGIRAECADCHVPQ--DS 76  [Haemophilus] ...
Q8E8S0          8 kPSAKYSILALLvVGIVIGVVGYFATQQTLHATSTDAFCMSCHSNHSLKNEVLASAHGGG-KAGVTVQCQDCHLPH--GP 84  Shewanella one...
Q3JCN9         21 RP---------VaVGAGGLFALIVIVFGGEAALSTTTFCTSCHSMSYPYEELQESAHY-G-RFGLQPQCKDCHIPQglGN 89  Nitrosococcus ...
Q2YA33          3 MK-----TGSALlVGTLLGVVMVAVVLGGEAAVSTTEFCTSCHSMTYPAEELKESSHY-G-ALGANPGCKDCHIPQglQN 75  Nitrosospira m...
WP_011138086    5 mnNSTKFALGLTfVGTLIGLLFSYAVYFGLKETSDAKFCALCHEMEPMILSYHQDVHGGAgRTGIQVDCVACHMPH--ES 82  Wolinella succ...
jgi:Dole_1635   4 M-KKHIKGLILIgVGVLLGFPVFSMTYYTMVRTSTPEFCASCHEIQPAVDAWRTSTHVNN-AQGFVADCMDCHLPAphNT 81  Desulfococcus ...
Q316P6          1 M-RRFLKPLFLVsLGVLVGFPVFSMTYYTMVRTSTPEFCASCHEIVPAYQSWKTSTHVNN-AQGVVADCMDCHLPAphQT 78  Desulfovibrio ...
WP_011761577   85 F-AYLKKKII-VSKDVIGFLtIDGFNTQEWLEANRKEQADLARDYLRSIDSSTCQNCHNRIyENQSENMSKMAVRMHSNN 162 Shewanella ama...
Q65V16         78 I-DYVKAKVI-ALKDVWFTL-TNKIPDRATFEEQRGELAQRVWDEMKANDSATCRSCHNED-AMIVSEQSDSAQKMHKLA 153 [Mannheimia] s...
jgi:HSM_1276   78 VfHYVKTKVF-AVKDLWHTYvTDKLPDEEAFEKHRLEMAKSVWQDLKESDSATCRSCHSFE-AMEMSSQTPTAQKMHKTG 155 Histophilus so...
Q7VLN0         77 W-HYVKAKVA-AVKDVWHTFvTNKIPDQEAYEKHRLEMAQHVWQDMKETDSATCRSCHSFD-AMVLAEQREAAQKMHKIA 153 [Haemophilus] ...
Q8E8S0         85 V-DYLIKKII-VSKDLYGFLtIDGFNTQAWLDENRKEQADKALAYFRGNDSANCQHCHTRIyENQPETMKPMAVRMHTNN 162 Shewanella one...
Q3JCN9         90 FhKAVYTHVVdGARELYLEL-VNDYSTLEKFNERRQEMAHHARMNLKGWDSVTCRDCHQDP-----QPAAKSGQRAHKKL 163 Nitrosococcus ...
Q2YA33         76 FhLAVATHVVdGARELYLEM-VNDYSTLEKFNERRLIMAHDARMNLKKWDSRTCRACHKNP-----QPPGADAKAAHKKM 149 Nitrosospira m...
WP_011138086   83 LlGYIFTKAKnGVVEGSIKF----FHGTDHIN-----WVKNRANRDQFVFDSGCLECHREI-IDPREGRETQAVRMHEHY 152 Wolinella succ...
jgi:Dole_1635  82 A-DFFYTKTLhGLKDVIAHF------VMDEYD--REENREKAYASFKND---QCMKCHRNIlYIPD---KRGAMLAHRDV 146 Desulfococcus ...
Q316P6         79 V-DFFFSKTYhGIKDVVAHV----LHGSEAYD--REKNRQAAYDSFTND---QCQKCHRNIlYMPH---NRGAMMAHRTV 145 Desulfovibrio ...
WP_011761577  163 Fkk-dpESRK-TCIDCHKGVAH-PYPKS 187 Shewanella amazonensis
Q65V16        154 K-----ETNQ-TCIDCHKGLVH-FMPET 174 [Mannheimia] succiniciproducens MBEL55E
jgi:HSM_1276  156 I-----ETNQ-TCIDCHKGIAH-FMPEi 176 Histophilus somni 2336
Q7VLN0        154 Q-----ETNQ-TCIDCHKGIAH-FMPEM 174 [Haemophilus] ducreyi
Q8E8S0        163 Fkk-dpETRK-TCVDCHKGVAH-PYPKg 187 Shewanella oneidensis
Q3JCN9        164 ------DDGW-TCIDCHQNLVH-APVEH 183 Nitrosococcus oceani ATCC 19707
Q2YA33        150 E-----TEGA-TCIDCHQNLVHkEVAET 171 Nitrosospira multiformis ATCC 25196
WP_011138086  153 KkllntPQ-KiACASCHTDTGH-QSLrt 178 Wolinella succinogenes
jgi:Dole_1635 147 Vna-lpGREK-RCVDCHRDLVH-NTVEF 171 Desulfococcus oleovorans Hxd3
Q316P6        146 Lyd-rsGRTR-KCVDCHRDLVHvDRPQY 171 Desulfovibrio alaskensis G20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap