Conserved Protein Domain Family
CDK5_activator

?
pfam03261: CDK5_activator 
Cyclin-dependent kinase 5 activator protein
Statistics
?
PSSM-Id: 397388
Aligned: 10 rows
Threshold Bit Score: 398.472
Threshold Setting Gi: 348517863
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EDW28394             95 HHLHNLANSskdTITNVLD--------AQNENGAIKSEKSSI----DKNLKKH--SIFINALSWKKL---STS-HNKKKI 156 Drosophi...
1_pfamImport          1 SPLPHRPQT---SVCNHLFs-------PGDGGPTFAPQQQES----PRPSAKE--SVLVQGWNWSKR---NIQpVMSRRS 61 
Q9V3H5               96 HNLNNLANAskdTITNVLD--------THNENSVLKAEKSSF----EKNLKKH--SIFINALSWKKL---STS-HNKKKI 157 fruit fly
WGS:AANI:GJ15405-PA  95 HNFNNLAYSskdTINNDLD--------AHNENSTVISEKSSI----EKSLKKH--SLFINALSWKKL---STA-HNKKKV 156 Drosophi...
XP_003724712         57 GDYGGYSDTttlSVGNLNEl-------YLNNSKNVASTKENIhlvgERPMRKHnsALFISALGLKMF---SVS---KKKT 123 purple s...
XP_003446452         20 GPATVGHYTavqNSKNAKD----------------------AaaaaAKSLKRP--SI-ISVLPWKRIvavSAKrKGSKKL 74  Nile til...
Q22695                7 SPLPHHHRTqttSVCNHLFs-------PGDGGPTFAPQRDSNtssrSSSNAKE--SVLMQGWNWSKR---NIQpVMSRRS 74  Caenorha...
EGT52205              7 SPLPHHHRTqttSVCNHLFs-------PGDGGPTFAPQRDSNassrNSSSAKE--SVLMQGWNWSKR---NIQpVMSRRS 74  Caenorha...
Q17C39              115 NINSNNNSNsiqERNNNNNt-------SNTDSARILSEKNAL----ERNLKKH--SLFINALSWKRL---AAS-HGKKKL 177 yellow f...
EEB17983             55 NNNNNNNHTtsnTNNNNTNhqihanhiNNNDNAKIISEKNTL----EKNFKKH--SLFINALSWKRF---STAnNNKKKL 125 human bo...
EDW28394            157 DN-KNKCANLPTACFKSQFLESTFASS-------------SDKNRNIQLQCNRIE--EHNQPNHNqpqd----------- 209 Drosophi...
1_pfamImport         62 LLkSSNMSEATSSKSSNSLVSFTCNAStfttkqsekttvsLDKNQNYKVNAVNDEnkELDVLRFVnld------------ 129
Q9V3H5              158 EN-KNKCANLPTACFKAQLLESSFASS-------------SDKNRNIQLHCNRID--EHNQQHCNqhphphphqhqlqlq 221 fruit fly
WGS:AANI:GJ15405-PA 157 EN-KNKCANLPTTCFKTQLLEASYTSS-------------SDKNKNIQLHCNHIEehQHQQHHCNqshi----------- 211 Drosophi...
XP_003724712        124 ----------SSTGVSTTSLDTNFNSSkqs-------ltgSDKANN-----NVLKpkNHSNQNTN--------------- 166 purple s...
XP_003446452         75 QSdSGDGGKGSSPDGHAAATTNSASNSl-----------kLKKSQS---------------------------------- 109 Nile til...
Q22695               75 LPkSGSSSEATSSKSSDSLVSFTRNVStstssqygkisisLDRNQN---------------------------------- 120 Caenorha...
EGT52205             75 LPkSGSSSVFQKQHHRNPVIVLFLSLEmlgll----lpvnMGKYQYHLTGIII--------------------------- 123 Caenorha...
Q17C39              178 DNqKNKSANLGSATFRTPLTD-TIHPM-------------VDKNKNLQQSQSFTQpiSHSNQQLQ--------------- 228 yellow f...
EEB17983            126 DN-KNKNLTI----FRQPLLD-NIHPI-------------VDKNKNIHKSTSIp-------------------------- 160 human bo...
EDW28394            210 -------------------ireDSGT-VTAKSQNPSKVKd--------------------------sIKVNNKNSICNHN 243 Drosophi...
1_pfamImport        130 -------------------sstSTSFySTWYKRIPRSVDqttiipnyy----------slreefrrgVEINHGHDAVNNN 180
Q9V3H5              222 nqhqhqnqnqnqnqnqvqdireEVMTgPPGKSQNPSKAKd--------------------------pVKVNNKNSMSNHN 275 fruit fly
WGS:AANI:GJ15405-PA 212 -------------------ireLPLF-PSTKAQKPSTAKe--------------------------lGRVNNTNSISNHN 245 Drosophi...
XP_003724712        167 ---------------------------NAVYRQYPDSVAiltpqkkdskmldssikksfscfnlnshCPSNAQNGHHQSH 219 purple s...
XP_003446452        110 ----------------------CANLsSYSSSQDPAATTtttssh-----------------lpaskTLANVATVVAKKN 150 Nile til...
Q22695              121 ------------------------------YKSVPRPSDtttiipnyy----------slreefrrgLQINTRQDLVNNN 160 Caenorha...
EGT52205            124 ------------------------------ISEIPRP-Dsttiitnyh----------tlhnefkrnCQINNRQDLVNNN 162 Caenorha...
Q17C39              229 ----------------------------QIQSQQPAAIQlqqqqhshpqqtvyftpggpkallaldlVRANNTNPLSQPD 280 yellow f...
EEB17983            161 ----------------------CYYPcLTVSKTVPSLSNpeeldg----------------hvdinlRSNNNSNNNANTN 202 human bo...
EDW28394            244 KLIQK--QPLTLSLP-----QQMQPSSMQFKNNNQ-------------------FPRKTVIQASTSELLKCLGIFLHCRC 297 Drosophi...
1_pfamImport        181 LNENG--NEYSISSSpkhvaKCTIPRLINPDDNGNedlinyegd--amlpesanGKRRTIIQASTSELLRGLGIFIANHC 256
Q9V3H5              276 KLIQK--QPLTLSLP-----QQVQASSIQTKNTNQ-------------------IPRKTVIQASTSELLKCLGMFLHCRC 329 fruit fly
WGS:AANI:GJ15405-PA 246 KLIQK--QPLALTLP-----QQLQISSIQIKNTNQn-----------------hLPRKTVIQASTSELLKCLGLFLHYRC 301 Drosophi...
XP_003724712        220 Kqh---------------kiSNVSGSTVTTTSTNGlngfrkvsshglrsssgvqTNPKKILQCSTSELLKCLGNFLCRRC 284 purple s...
XP_003446452        151 ---------------------SLTGSGIQPSTAAG-------------------TPKRVIVQASTSELMRSLGEFLCRRC 190 Nile til...
Q22695              161 LAS----NDLSVIGSpkhvpR---PRSVLRDDNANcdispia------------eqenvpsEASTSELLRGLGIFISNNC 221 Caenorha...
EGT52205            163 LTA----NELSIIGSpthvpR---PRSI-RDDNANdecdqqe-----nyisekrGTKKTIIQASTSELLRGLGIFISKNC 229 Caenorha...
Q17C39              281 KLAPK--LPLQLPLPlqpiiSQQQAVAVAQQQQNQlsqql---------hhsghGPRKTVIQASTSELLKCLGMFLHDRC 349 yellow f...
EEB17983            203 NTSSSfcEKLGPKTNlsnipQSQTSSAISNSSHHQv------------------PPRKTVIQASTSELLKCLGIYLHNKC 264 human bo...
EDW28394            298 qRLSNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRDLVDGEE---SKESDLQASVLTCLYLSYSYMGNE 374 Drosophi...
1_pfamImport        257 -TVKDFNPVHLVTWLRSVDRSLLLQGWQDIAFINPANLVFIYMLVRDELPGERhliNTLEELHAWTLSCLYVSYSYMGNE 335
Q9V3H5              330 qRLNNFDAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELVSGEE---SKESDLQASVLTCLYLSYSYMGNE 406 fruit fly
WGS:AANI:GJ15405-PA 302 hRLNKFDPGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELVNGEE---TKESDLQASVLTCLYLSYSYMGNE 378 Drosophi...
XP_003724712        285 pYLKSFDANDAIMWLRAVDRSLLIQGWQDINFLNPANVVFVYMLVRDLLSGDAv-vKNESELQAMVLTCLYLSYSYMGNE 363 purple s...
XP_003446452        191 yRLKRLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVVSAEV---ASERELQASLLTCLYLSYSYMGNE 267 Nile til...
Q22695              222 -DVSDFDPAHLVTWLRSVDRSLLLQGWQDIAFINPANLVFIFLLVRDVLPDERhliHTLEELHAWILSCLYVSYSYMGNE 300 Caenorha...
EGT52205            230 -DVSDFDPAHLVTWLRSVDRSLLLQGWQDIAFINPANLVFIFLLVRDVLPDERhliRTLEELHAWILSCLYVSYSYMGNE 308 Caenorha...
Q17C39              350 rKLRDFQAGDAVMWLRAVDRSLLLQGWQDVAFINPANVVFVYMLVRELVDGEE---TKEAELQAAVLTCLYLSYSYMGNE 426 yellow f...
EEB17983            265 yRLKDFQAGDAVMWLRTVDRSLLLQGWQDVAFINPANVVFVYMLIRELVEGNE---ETEHELQILVLTCLYLSYSYMGNE 341 human bo...
EDW28394            375 ISYPLKPFLVEDSKDKFWDRCLVIVNKLSDKMLKINAEPGFFTEVFTELKSCGQY 429 Drosophila persimilis
1_pfamImport        336 ISYPLKPFVIGNDRAKFWNRCMSMVTTHSRKMLLLNSSSSYFSEVFSDLKHCLTE 390
Q9V3H5              407 ISYPLKPFLVEDSKEKFWDRCLVIVNKLSDKMLKINAEPGFFTEVFTELKSCGQY 461 fruit fly
WGS:AANI:GJ15405-PA 379 ISYPLKPFLVEDSKENFWDRCLFIVNRLSSKMLKINAEPAFFTEVFTELKSCGQF 433 Drosophila virilis
XP_003724712        364 ISYPLKPFLVEEDKDRFWSRCIKIINSCSSKMLRINQNSNYFTDVLADLKSFARS 418 purple sea urchin
XP_003446452        268 ISYPLKPFLVEAEKEAFWDRCLDIINRMSGKMLQINTDPHFFTQVFADLKNESKK 322 Nile tilapia
Q22695              301 ISYPLKPFLIGNDRNTFWNRCVAMVTSHSRQMLLLNSSSTFFSEVFTDLKHCSSS 355 Caenorhabditis elegans
EGT52205            309 ISYPLKPFLIGNDRNTFWNRCVSMVTSHSRKMLLLNSSSTFFTEVFTDLKHCSSP 363 Caenorhabditis brenneri
Q17C39              427 ISYPLKPFLVEDSKDKFWDRCLLIVNRLSSNMLRINAEPGFFTEIFTELKACGMN 481 yellow fever mosquito
EEB17983            342 ISYPLKPFLVEDSKEQFWDRCLNIVNRLSRNMLRINAEPGFFTEIFTELKGCGAT 396 human body louse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap