Conserved Protein Domain Family
Rer1

?
pfam03248: Rer1 
Rer1 family
RER1 family protein are involved in involved in the retrieval of some endoplasmic reticulum membrane proteins from the early golgi compartment. The C-terminus of yeast Rer1p interacts with a coatomer complex.
Statistics
?
PSSM-Id: 397380
Aligned: 119 rows
Threshold Bit Score: 170.787
Threshold Setting Gi: 122050588
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5KPE9               71 ENTNVWAR---KWQGLLDRSTPHVLERWLVTLGLFLLFALNVILRQGWYIVCYALAIYILNLFLAFLQP-RFDP--SLAE 144 Cryptoco...
XP_001611309         17 rlQNRLAFfqrGRQAILDYISTHIVLRWIYFVILFYVFWYRVIAYASHFVIAYMYAVYALNSVIRFLTPlDF------QD 90  Babesia ...
Q57XM3               15 KFTDNIKM---TWSRLLDQTVPHRPLRWVMFVFMLSLYILRVYFCGGFYVISYVLGIHLLFLLVQVITP-LADE--DLGS 88  Trypanos...
Q4D9J0               15 EFKRKAHL---TYQRYLDKTVPHRAMRWAMFGFLLMFYILRVFFHGGFYVITYGMGIHLLYLLLLLVTP-LAED--EFAE 88  Trypanos...
Q4QBT9               15 TFLRKARV---TYKRYLDASVPHCALRWCFFAFLAILYVARVVTFGGFYVITYGLCIHLLYLLLLLITP-LSDP--DESE 88  Leishman...
EAX97405             14 IDKQEALM---RFESLLYQIKPYLWQRWCAFGFMMFLFLLRVFTWHAYYYIVYIIGLYLLSCVVEFISP-KRDP--ELYG 87  Trichomo...
EIJ89068              1 ---mKLQH---LIQSYADMSVGMIKQRWCAFLFLFVVFVWRIILTGGYRLVAYCLFLYFLHCFIGFCTPvDS-------- 66  Nematoci...
WGS:AFBI:EDEG_01145   1 ---mnIKT---IIQIYLDKLAPMKKERWVFLILFMILYFLRIIVIQQFFLITYCVSIYLLHGLIEFLTPkEE-------- 66  Edhazard...
EPR78825              1 ---meLTT---LFNHYLDKITPKRLERWIGFTLLEIFFLLRIYILNSHHLVTYIVSVYLLHSLVMFLTPrDE-------- 66  Spraguea...
A0CS82               14 KAIHRVKV---NYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYIVTYIYCVYQLQLLIDYFTPlGL-PpvNLED 89  Parameci...
Q5KPE9              145 dla-adDVEEGApGLPgaGpaktpgglkgllngfsngEEDE-----------------EFRPFIRRLPEFKFWYSATKAN 206 Cryptoco...
XP_001611309         91 lcaaheAAHGGT-ILP---------------------SSEGnrteitlekmrhpdtvyEFRPFLRDMNEFTFWLCLVRAT 148 Babesia ...
Q57XM3               89 e-----------gQLP--Hta---------------aSPDE-----------------EFRPFVPRMQEFVVWCSMMKSV 123 Trypanos...
Q4D9J0               89 d-----------sPLP--Rta---------------aGNDG-----------------EFRPFVPRVQEFVVWKSMFRVV 123 Trypanos...
Q4QBT9               89 g-----------tPLP--Mt----------------hTDSD-----------------EYRPFMPKVQEFVVWKQMFTVL 122 Leishman...
EAX97405             88 e-----------eVLP--S------------------AKDG-----------------DYKPFVRRLPEFQFWCCCMPAS 119 Trichomo...
EIJ89068             67 -------------ELP--Dpfdieeee--tvisspikKSGD-----------------ESKPFIRRLPEFEYWLQSIKAC 112 Nematoci...
WGS:AFBI:EDEG_01145  67 -------------NIP--Dpfdnfed-----dvyeqtTLDD-----------------EYRPFIRRMPEYKFWMFCMQLI 109 Edhazard...
EPR78825             67 -------------SIP--Dpfeefde----yeeyipqTVDD-----------------EFRPFLRRLPEFDFWCRSMGLI 110 Spraguea...
A0CS82               90 eeedddQFQNDFsELP--Ttlsn-----------kneLNDK-----------------EFRPLLRTTSEFKVWQKSVFSV 139 Parameci...
Q5KPE9              207 AIALLCTITRATDVPVYWPILLVYFFTLFGLTMRRQIQHMIKYRYVPFDLGkKARYG 263 Cryptococcus neoformans
XP_001611309        149 YVALFCMLFDALDVPVFWPLLVVYFVGLFALTMREQLENMIKYKYVPFNIG-KRTYG 204 Babesia bovis T2Bo
Q57XM3              124 LVCTFLTLFRILDIPVFWPVLLLYFIFLTIIQVGERIRHMIRHRYVPWSAG-KPKFV 179 Trypanosoma brucei
Q4D9J0              124 SICLFLTLFNFLDIPVFWPILLLYFIVLTVTQMGSRIKHMMKHRYVPWNAG-KPKYV 179 Trypanosoma cruzi
Q4QBT9              123 FVCLFLTMFSFLDIPVFWPILVLYFLALFATQVGGRVRHMIKHGYVPWNAG-KPKFV 178 Leishmania major
EAX97405            120 VLACFFSLMP-FDLPVYAPLLFVYFIVVSVFVFRKRIMHMIKYKYVPWDTG-KQKYQ 174 Trichomonas vaginalis G3
EIJ89068            113 FAGIVMTFFPVFNIPVFTPILIIYFCGLVYLTVIKIRKHMEKYKYNPFFNA-KKIYK 168 Nematocida parisii ERTm3
WGS:AFBI:EDEG_01145 110 GTAFMCTFFDFLDIPVYVPILIFYFIVIAALTAKNMHRHMKKYKYNPFFKA-KDVYV 165 Edhazardia aedis USNM 41457
EPR78825            111 LFAWFTTFFSFFNITVYVPILILYFIFMIFLTAHKMYKHIKKYHYNPFFGD-KEQYG 166 Spraguea lophii 42_110
A0CS82              140 IFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMKKYGYTILDFT-KKK-- 193 Paramecium tetraurelia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap