Conserved Protein Domain Family
COQ7

?
pfam03232: COQ7 
Ubiquinone biosynthesis protein COQ7
Members of this family contain two repeats of about 90 amino acids, that contains two conserved motifs. One of these DXEXXH may be part of an enzyme active site.
Statistics
?
PSSM-Id: 397371
Aligned: 141 rows
Threshold Bit Score: 134.925
Threshold Setting Gi: 504005294
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006687001        42 YLDRVIRVDQSGELGANLIYNAQYVVLANRYPHLKPVLQHMWDQELHHYSTFNDLQVRRRVRPSLLTPLWKVGAVGLGAV 121 Yamadazym...
WP_012969418        57 HVARLMRINHTGEVCAQALYQGQALT--AKLPETRQRLERSAKEENDHLAWCEERLDELGDRKSLLNPVWYAGSFALGAL 134 Allochrom...
jgi:Thimo_1181      52 HIARLMRVNHTGEVCAQALYQGQAVT--AHLPTVRETLERSAAEETDHLAWCETRLRELGERRSLLNPVWYTGSFAMGAL 129 Thioflavi...
goetting:Loa_02888  50 HIAGLMRVNHTGEVCAQALYQGQALT--AKLTEVKVQMAEAAEEEVDHLAWCEQRLNELNSQVSLLNPLWYSGSLMLGMI 127 Legionell...
WP_012639341        49 haGRLMRVNHAGEVSAQGLYQGQALT--ARNAVVRENMERSAEEENDHLRWCQARMDALGAHRSYLNPLWYAGSFTLGAI 126 Thioalkal...
WP_025280422        49 lsARLMRVNHAGEVAAQGLYQGQALT--ARREEVRERMERSAREENDHLAWCANRLRVLDGHTSVLNPLWYAGSFTLGAL 126 Ectothior...
Q3JCJ6              51 lsgcLMRVNHAGEVAAQALYQGQALT--ARLTEIRKAMENAAREENEHLVWCQQRVQELGAHTSYLGPFWYGGSFVIGAL 128 Nitrosoco...
jgi:Nhal_0847       52 lsgcLMRVNHAGEVAAQALYQGQALT--ARLTEVRQAMEGAAREENDHLAWCKQRVHELGTHTSYLNPFWYTGSLAIGSL 129 Nitrosoco...
jgi:Astex_0733      11 LIRRILRVNHAGEHGAVSIYSAQLKRLPSGANDLEAWLKETLSHENEHRLAFREAMSSRFAKPCRALSVWSVGGWFLGSI 90  Asticcaca...
WP_015818466         3 EVERIIRVDHAGEYGAIHIYRTQLFLAKYLYKDVAPKIEEMLSHELVHYSTFNSLLKKRNIRSCYGIHLWAFGGVLLGLA 82  Teredinib...
XP_006687001       122 TALISKEAAMACTVAVETVIGNHYNEQLRVLMNqydvpiyekntgeviskeslemtlrtsPELRQLKEFIKEFRDEELEH 201 Yamadazym...
WP_012969418       135 AGLAGDKWSLGFVVETERQVEDHLDDHLAQIP----------------------------AHDEKSRAILERMKADEIHH 186 Allochrom...
jgi:Thimo_1181     130 AGLAGDNWSLGFVVETERQVESHLEGHLREIP----------------------------ERDTKTRTLIHQMKADEIHH 181 Thioflavi...
goetting:Loa_02888 128 AGLAGDRWSLGFVAETERQVTAHLEKHLGNLP----------------------------AQDDKTKAILAQMQVDEAHH 179 Legionell...
WP_012639341       127 AGLAGDRWSLGFVGETERQVEHHLDEHLDTLP----------------------------EADARSRAVLAQMREDEIHH 178 Thioalkal...
WP_025280422       127 AGAAGDKWSLGFVNETEQQVVRHLDDHLGRIV----------------------------VEDGPTRAVLEQMKIDEAHH 178 Ectothior...
Q3JCJ6             129 AGMAGDKWSLGFVAETEHQVVKHIERHLDRIS----------------------------AQDAPSRAILEQMKEDEARH 180 Nitrosoco...
jgi:Nhal_0847      130 AGIAGDKWSLGFVAETERQVVKHLERHLDRIP----------------------------DQDAPSRTILEQMQKDEARH 181 Nitrosoco...
jgi:Astex_0733      91 TSTWGRTGIFACTAAVERTVHAHLEEQIAFLRH----------------------------HDTELAALVERIQIEEISH 142 Asticcaca...
WP_015818466        83 SGLLGRNAIWVCTASIESTVLHHLEWQMDYLSK----------------------------NDTEAFEAVASIKADEEEH 134 Teredinib...
XP_006687001       202 LETAIEHDAKK--AVPYM-LLTETIKLLCHGAIYTAER 236 Yamadazyma tenuis ATCC 10573
WP_012969418       187 AQVAKSAGGADlpAPIRQ-AMKLTSRVMTRTAYWv--- 220 Allochromatium vinosum
jgi:Thimo_1181     182 AEVAKRGGGADmpRPIQW-AMKAAAKVMTRTAYWv--- 215 Thioflavicoccus mobilis 8321
goetting:Loa_02888 180 AQVARDAGALElpFWIKQ-LMSGVSKLMTKssyyi--- 213 Legionella oakridgensis ATCC 33761 = DSM 21215
WP_012639341       179 GAKAMDLGGAElpWVVRKvVMPAVSKVMTRTAYwl--- 213 Thioalkalivibrio sulfidiphilus
WP_025280422       179 GELAMSLGGAElpWPVRRvMMPAVSKVMTRIAywv--- 213 Ectothiorhodospira haloalkaliphila
Q3JCJ6             181 ATVALEAGGVElpSSIKA-LMGAASKVMTRTAYWi--- 214 Nitrosococcus oceani ATCC 19707
jgi:Nhal_0847      182 ATVALESGGVElpTPVKA-LMGIVSKVMTRTAYWv--- 215 Nitrosococcus halophilus Nc 4
jgi:Astex_0733     143 LSYAEERLGPK--SGLAA-SLRTVISFATEVLIALSTR 177 Asticcacaulis excentricus CB 48
WP_015818466       135 QNYGATN-ASS--SYLYK-PLFSIVRGTTEFAIWLSTK 168 Teredinibacter turnerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap