1RPU


Conserved Protein Domain Family
Tombus_P19

?
pfam03220: Tombus_P19 
Tombusvirus P19 core protein
Statistics
?
PSSM-Id: 397364
Aligned: 3 rows
Threshold Bit Score: 320.032
Threshold Setting Gi: 123864320
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RPU_A   1 MERAIQGNDTREQANGERWDGGSGGITSPFKLPDESPSWTEWRLYNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE 80 
Q9E348   1 MERAIQGSDAWQQTGGQRRVGGCGDSFAPFQLPDESPTSDEWRLHHDAYDPDTDCPLGFKEFWSVGKAISKRYHRYDWKE 80  Maize necrotic streak...
P11690   1 MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLHNDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTE 80  Tomato bushy stunt vi...
1RPU_A  81 ASLHRVLGSWTGDSVNYAASRFLGANQVGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGC 160
Q9E348  81 ASLDRALGSWQGDKVITEASRFLGVDQVSCTYSIRVRGVSITLSGGSRALLRLVSMADRIKRSELQFATSAVESVVSRGC 160 Maize necrotic streak...
P11690  81 ASLHRVLGSWTGDSVNYAASRFFGFDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQELLQLAPIEVESNVSRGC 160 Tomato bushy stunt vi...
1RPU_A 161 PEgIETFKKES 171
Q9E348 161 PE-EETPKESE 170 Maize necrotic streak virus
P11690 161 PEgTETFEKES 171 Tomato bushy stunt virus (STRAIN CHERRY)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap