Conserved Protein Domain Family
TLC

?
pfam03219: TLC 
TLC ATP/ADP transporter
Statistics
?
PSSM-Id: 397363
Aligned: 11 rows
Threshold Bit Score: 611.268
Threshold Setting Gi: 146739606
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAM79379       2 QKTNI-LKKFTKALWPIELHEMKLFMPMALIIFCLLFNFSALRAIKDSLVVPSV---GAEVISFLKLWLVLPSAIIFTLT 77  Orientia tsutsu...
O84502         2 SSEVKsFSKFRGYFFPIYRSEFSKFIPLFFLAFFVGVNYALLKTTKDSLVLVGSr-aGAEVIPFLKVWGIVPGAVIVTMI 80  Chlamydia trach...
Q6MEN5         5 PTGSReFSPWRSNLWPVHRYELKKLIPMLLIFFFISFDYNILRTLKDSLLITAKs-sGAEVIPFVKVWAMFPGAILMTLL 83  Candidatus Prot...
Q6MEN4         2 SQQESeFGKLRAFFWPIHGHEVKKVLPMMLMLFLICFNYSILRNVKDAIVVTAKa-sGAEVIPFIKVWVLLPTAVLFTLI 80  Candidatus Prot...
WP_011526090  10 SMPEEdFTGWRAILWPVYNFELKKFLPMGLMMLCILFIYRLVRDIKDTLMVSQAtggGAETLGFLKLWGVTPSAILFMII 89  Lawsonia intrac...
O05962         5 spSRSfKNKFRAAFWPVHNYELGKFIPISALMFCILFNQNILRILKDSILISEI---SAEIAGFAKVYCVTPVAALFVII 81  Rickettsia prow...
Q9ZD47        13 sKINShFSKLTDYIWPIKRHEISKFLFITLLMFCILFIQNLIRALKDSIVTTMI---GAETISFLKFWGVMPSAFLITVI 89  Rickettsia prow...
Q6MEM5         3 QDAKQdFGKWRAFFWPVHGYELKKLLPMFFMFFFISFNYTILRDTKDTLIVTSA---GAEAIPFLKSFGVVPAAILFMII 79  Candidatus Prot...
WP_006340593   3 NESKPeFGPLRSFFWPVHNYELRKLLPMFLMFFCISFNYTILRDTKDTLIVTSS---GAEAIPFLKVWGVVPAAIIFMLL 79  Parachlamydia a...
O84068         3 QTAEKpFGKLRSFLWPIHMHELKKVLPMFLMFFCISFNYTILRDTKDTLIVTAPg-sGAEAIPFIKLWLVVPSAVVFMLI 81  Chlamydia trach...
P92935        89 DEGDTaAMAVSPKIFGVEVTTLKKIVPLGLMFFCILFNYTILRDTKDVLVVTAKg-sSAEIIPFLKTWVNLPMAIGFMLL 167 thale cress
CAM79379      78 YVKLSNSYSMENIFYIIVTFFLIFFLLFAFIVYPNEMLLHPSEELIKEAIYNYPHLQWIIRICGKWSYAVMYIICELWSV 157 Orientia tsutsu...
O84502        81 YGWMSRRYSRGTVFISLVGGFLGFFALFATVIYPIGDALHLNKLAAKLQSILPPGGRGFVVMVQYWSYSLYYVMSELWSS 160 Chlamydia trach...
Q6MEN5        84 FTWLSNRLSREIVFYLITSLFLSYFFIFTFILYPIRDIIHPHATADYLETILPIGFKGLVAMFRYWTFTIFYVMSELWGS 163 Candidatus Prot...
Q6MEN4        81 FTKLSNRFSQEKVFYIVISTFLLFFGSFTYIFYPLRDVLHPHQLCDYLETILPAGFKGLIAMFRNWSFTLFYVICELWGS 160 Candidatus Prot...
WP_011526090  90 FVKLANKLSKANLFYTIVSFFLGFFVLFGLVIYPLTEYFHMSYETISHLQTTMPRLYWVWPIIGNWSYAIFYILSELWGS 169 Lawsonia intrac...
O05962        82 YAKMINHLTFEKIFYYLSAFFISCFILFAFVIYPNIHIFHVHPDTLSDWMNKYPHFKWYISLVGNWGYIVYYSLAELWPN 161 Rickettsia prow...
Q9ZD47        90 YVKLVNRMKAENIFYLIISIFLTFFALFAYVIFPNHEMLHLRPVTVHNLTASLPNLKWFILLLSKWSFSLFYIIAELWPN 169 Rickettsia prow...
Q6MEM5        80 YAKLSNTLSRENLFYVTLLPFIIFFGLFAFVMYPAREVLMPHASAEALKAYLPGGWTGLAAAYENWMYSIFYILAELWGS 159 Candidatus Prot...
WP_006340593  80 YAKLSNILSKEKLFYVTITPFIVFFALFATVLYPNKDFLHPTTSAEYIQSFLPEGLGGLVACYRNWTYSLFYILSELWGS 159 Parachlamydia a...
O84068        82 YAKLSNILNKQALFFAVLSPFVVFFALFPVVIYPCRHILHPTAFADTLQSILPSGFMGFIAMLRNWTFAVFYVLSELWGS 161 Chlamydia trach...
P92935       168 YTKLSNVLSKKALFYTVIVPFIVYFGAFGFVMYPLSNLIHPEALADKLLATLGPRFMGPLAIMRIWSFCLFYVMAELWGS 247 thale cress
CAM79379     158 VVINLMYWQFANNMFNIKDAKRFYPALGMIGNLGLIVAGNVLIACANnseisiasdIFVINSDCA---KNSEAIFKHIVI 234 Orientia tsutsu...
O84502       161 IVLSTLFWGVANHITSVREAGRFYALINTGLNLSSVFAGEVSLWLGRn--------PVIAFPMAV---DPWHEVLLNITL 229 Chlamydia trach...
Q6MEN5       164 TVLFVLFWGFANQVTKISEAKRFYGLFGVGANLSGIFAGQASVYCCQ---------FNKQNDLGIlgsDPWYQSLVMMVS 234 Candidatus Prot...
Q6MEN4       161 IVLTVLFWGFANEITKMTEARRFYSMLGVIASFAATIAGIIANLLSN-----------------D---QSWEQTLNILMV 220 Candidatus Prot...
WP_011526090 170 VVLSALFWQFANEITKISEAKRFYSLFGFVGNFGLLASGSIIIICANi-------aKNSAVDGTI---DVFGESLKYQML 239 Lawsonia intrac...
O05962       162 IFYVLLFWQFTNELTTTEEAKRFYTLFSLFGNSSLILVGFLMMNLSSed------tIIKKFISIS---DSKITLVQVSTT 232 Rickettsia prow...
Q9ZD47       170 VVFALLFWQFVNNITTVEESKRFYPLFGLLSQTGIYLAGHFLENLSNin-----yyVTNKFALQS---SFHTLSIQIILT 241 Rickettsia prow...
Q6MEM5       160 VVLSLLFWGFANQITRVNEAKRFYSLFGLGANLALLVSGPAIVYVSD---------IRKHLPANV---DAWQISLNYLMG 227 Candidatus Prot...
WP_006340593 160 AVLSLMFWGFANDIMKITEAKRFYTLLGLGANVALLVSGPAIMYFSD---------IRKHLPAGV---DAWQVSLNYLMG 227 Parachlamydia a...
O84068       162 VMLSLMFWGFANEITKISEAKRFYALFGVGANVALLISGPAIIWSSK---------LRASLGEGV---DPWGVSLYFLMA 229 Chlamydia trach...
P92935       248 VVVSVLFWGFANQITTVDEAKKFYPLFGLGANVALIFSGRTVKYFSN---------MRKNLGPGV---DGWAVSLKAMMS 315 thale cress
CAM79379     235 VVTIFGIIAILTFKYLNNLV---------LGKAVImhnkdnlmNNLKLY-NHGTTKLSLKDSIKLILRSDYISRIAIMVI 304 Orientia tsutsu...
O84502       230 LIVLAGGVILYLYQKLDRLMdetsmlkegLAAEMS--------VAQLKK-EKKRSKAKAKSLFALLLRSRYLLGIAVVVL 300 Chlamydia trach...
Q6MEN5       235 LILLSGALVLALFRWMNVEV---------LTDKRFyd-----pSSVKTE-GEAKGKLSLKQSFSYLLRSNYLLCIALIVI 299 Candidatus Prot...
Q6MEN4       221 AVIVSGTIAMVIFRWMNKNV---------LNGPEFqe-----fHEAKRI-QKMKKRLSIRESFTYLANSKYLICIAVLVI 285 Candidatus Prot...
WP_011526090 240 AVLFFGLLLLYLYRWMNKNV---------LTDPKLy------tPGAGSK-KKSKPKLGLIESTKCILTSRYLLMISALVI 303 Lawsonia intrac...
O05962       233 IIAIVAIICCLLVRFISKYI---------FTNPLFy-------HKTKSS-RSTAQRMGLIKSFKYIVKSKYLWLLLICSA 295 Rickettsia prow...
Q9ZD47       242 IVLILGIVSIKTFWLLNHKV---------LDKKHM---------ALLRF-KTKNKSITIAKSFQMILSSRHIRLIATLLI 302 Rickettsia prow...
Q6MEM5       228 MVVIAGLAILAIYWWINRAV---------LTDPRFyd-----lNQEKAPgKKKKAKMSLGESFKFLFTSKYILCLAILVI 293 Candidatus Prot...
WP_006340593 228 SVVLAGVCVVAVYWWMQRNV---------MTDPRYyd-----pSDVKQP-KKAKAKMSIMESFAFLGKSKYILCIAILVI 292 Parachlamydia a...
O84068       230 MFLCSCAIIAACYWWMNRYV---------LTDPRFyn-----pAELKA--KKSKPKMSMGESFSYLLRSPYMLLLALLVI 293 Chlamydia trach...
P92935       316 IVVGMGLAICFLYWWVNRYVp--------L-------------PTRSKK-KKVKPQMGTMESLKFLVSSPYIRDLATLVV 373 thale cress
CAM79379     305 CYGLSINILEGPWKAQIKELYPTTQEYITFMGKFNVVMGISCVMFM-GMSSSILHKFNWLFPALITPLIIGVTGIIFFLL 383 Orientia tsutsu...
O84502       301 SYNLVIHLFEVVWKDQVCRIYASRVEFNSYMSRITTLTGIVSALTGiFAAGQTIRRWGWTIGALVPPLTMLITGALFFGA 380 Chlamydia trach...
Q6MEN5       300 SYNLVINLTEVLWKHQVRELYPDPNDYTLYMNHIVSIIGVVATLSSlFVSGNAIRKFGWTTTALITPIILAVTSLGFFSF 379 Candidatus Prot...
Q6MEN4       286 SYNLVINLVEIVWKDQLRQLYSSALDYNRYMNNMTSAVGIIATITS-LFMSTMITRFGWTRTALVTPTIMLVTSVGFFAF 364 Candidatus Prot...
WP_011526090 304 GYGISINLVEGVWKGQIKLLYPDPNDFNVLMGKLALTTGFVTIIIM-LIGANILRRFSWRTAALITPIFLMATSVIFFGV 382 Lawsonia intrac...
O05962       296 AFGFAINLVEAVWKAKIKELYPTVNTYAEFNSLYILWTGVAIIVMT-IIGNNVMRMHNWFVAAVISPVIIMVTGVLFFGL 374 Rickettsia prow...
Q9ZD47       303 CYGIAINLVEGPWKAAATKIYKTPTEYAAFIGSYLSYTGVFTIFFV-LLGSNIVRRMGWFTSAVITPSIVFITGILFFAV 381 Rickettsia prow...
Q6MEM5       294 AYGISINLVEITWKSQVKLQYPNPNDYSTFMGWFSTMTGAVTILMMlFVGGNVIRHKGWGFAALITPVVLLVTGIAFFSF 373 Candidatus Prot...
WP_006340593 293 CYGISINLVEVTWKNQLKLQYPNPNEYNTFMGAFSTFTGAITIIMM-FVGGYIVRKKGWGFAAMTTPTVLLLTGLGFFSF 371 Parachlamydia a...
O84068       294 CYGICINLVEVTWKSQLKMQFPNPNDYSAFMGNFSFWTGVVSVFVMlFIGGNVIRRFGWLTGALVTPIMVLVTGAVFFAL 373 Chlamydia trach...
P92935       374 AYGISINLVEVTWKSKLKAQFPSPNEYSAFMGDFSTCTGIATFTMM-LLSQYVFKKYGWGVAAKITPTVLLLTGVAFFSL 452 thale cress
CAM79379     384 IITGETASTIFSTV-GYSPIYLAVLVGASQNILSKSSKCSLFDATKEIAYIPLDIETKIKGKAAVEVVGAKLGKSGGAFI 462 Orientia tsutsu...
O84502       381 IYAVKGDAMIFGGIlGISPLVLTAWLGGVQNVFSRAIKFTYFDQTKEMAFIPLEDDEKNYGKAAIDGVISRVGKSGGSLV 460 Chlamydia trach...
Q6MEN5       380 FFLKKASPEIFLSFsGVTPLVLVVFFGTAQNILSRGAKYSVFDATKEMSFVPLNPESKLVGKAAIDGVCSRLGKSGGSVV 459 Candidatus Prot...
Q6MEN4       365 MLFRNDLADPVYILtGTTPLTIAVFFGAAQVCMSKACKYSVFDSTKEMAFIPLDYESKLKGKAAIDGVGSRLGKSGGSLI 444 Candidatus Prot...
WP_011526090 383 IIYENKMG-LDATLwGFGVLLLAVVVGLMQNAFSKGVKYSLFDATKQMAYIPLDPELKVKGQAAVEILAGRLGKSGGAAI 461 Lawsonia intrac...
O05962       375 IVFDQQILSLFDGAiLMSPLALAVSIGGIQNILAKGTKYSIWDTSREMLYIPLDDELKTKGKAAVDVISAKVGKSSSGLV 454 Rickettsia prow...
Q9ZD47       382 NNFEGFAGLIIANFiLTDPALVAITIGAIQNVLSKSSKYTLFDSTKEMAYVPLEPEIKISGKAAADVIGTKLGKSGSAFL 461 Rickettsia prow...
Q6MEM5       374 VIFKDHLAGYIAAL-GTTPLFLAVIFGAAQNIMSKSAKYSLFDPTKEMAYIPLDDESKVKGKAAVDVVGARLGKSGGSII 452 Candidatus Prot...
WP_006340593 372 VIFRDSLQGYIAML-GTTPLMLAVVIGMIQNIMSKSTKYSLFDPTKEMAYIPLDQESKVKGKAAIDVVGARLGKSGGSFI 450 Parachlamydia a...
O84068       374 VIFRDHATGLVAAL-GTTPLMLAVVVGAIQNILSKSTKYALFDATKEMAYIPLDQEQKVKGKAAIDVVAARFGKSGGSLI 452 Chlamydia trach...
P92935       453 ILFGGPFAPLVAKL-GMTPLLAAVYVGALQNIFSKSAKYSLFDPCKEMAYIPLDEDTKVKGKAAIDVVCNPLGKSGGALI 531 thale cress
CAM79379     463 QFLILTLYp-eSTISSISAILMGVFILVVLIWLIDVVNLYHKY 504 Orientia tsutsugamushi str. Boryong
O84502       461 YQGLLIIF---SSVAASLNAITIVLLLALGSWIFVIAWLGREY 500 Chlamydia trachomatis D/UW-3/CX
Q6MEN5       460 HQSLLLLF---STINASAPYVAIVLFAVILVWAMAIRVLGKQF 499 Candidatus Protochlamydia amoebophila UWE25
Q6MEN4       445 HQSLLMIF---ATVSSSAPYVAVILIGVIIVWMLCVRSLGKQF 484 Candidatus Protochlamydia amoebophila UWE25
WP_011526090 462 QSIMLLIIggnVTLASQVEFLGSAVLVVVAFWIISVFGLSKQF 504 Lawsonia intracellularis
O05962       455 QSIIFTLVp-nATFTSISPILMVVFTFVCFAWIYAVRKIYFEY 496 Rickettsia prowazekii str. Madrid E
Q9ZD47       462 QSLIFIILp-sASYQSISICLMIIFILTCVTWIWATKELNKEY 503 Rickettsia prowazekii str. Madrid E
Q6MEM5       453 QMGLL-AF---GTLATITPYIGAILMVIIAAWIVAARSLSKQF 491 Candidatus Protochlamydia amoebophila UWE25
WP_006340593 451 QQGLLVFF---GTISAITPYVAVATIAVIVVWMIAVRSLNKQF 490 Parachlamydia acanthamoebae
O84068       453 QQGLLVVC---GSIGAMTPFLAVALFAIIMVWLTSATKLNKLF 492 Chlamydia trachomatis D/UW-3/CX
P92935       532 QQFMILTF---GSLANSTPYLGVILLGIVTAWLAAAKSLEGQF 571 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap