6HUY,3F46,4YT2


Conserved Protein Domain Family
HMD

?
pfam03201: HMD 
Click on image for an interactive view with Cn3D
H2-forming N5,N10-methylene-tetrahydromethanopterin dehydrogenase
Statistics
?
PSSM-Id: 397354
Aligned: 15 rows
Threshold Bit Score: 122.837
Threshold Setting Gi: 1552508683
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HUY_C       197 ELVSPVGDMGIVTTAIAFAGAIEYYKVSRDILKTKRSMTEFQIAQSLQVISSLVTKYGLEGLIKLLNVDAMKASLQSMIL 276 Desulfurobacter...
Q58125       195 DVVPAVADMGALVTAVALVGVLDYYRVGTQIINAPKDMIEKQILISLQTIASIIETSGMEGLMKVFNKDALLSSAKNMLI 274 Methanocaldococ...
WP_013413427 194 DVSSAVGDMGVLVTAVTLAGILEFYHAAAKITSSPQKMVENQIVLTLETIAALVSTKGIDGTLKLLKPNIIINCAKSMNY 273 Methanothermus ...
WP_013329929 244 ELIGPVCDMCAALTAITYAGLLVYRDAVMNILGAPAGFSQMMATESLEQITAYMKKVGIKNLEENLDPGVFLGTADSMNF 323 Methanolacinia ...
3F46_A       244 NLIGPVCDMCSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKGIANMEEALDPAALLGTADSMCF 323 Methanocaldococ...
Q6M0Z1       244 NLISPVCDMGSAVTAPVYAAILAYRDAVTQILGAPADFAQMMADEAISQILDLMRNEGIKNMEDKLNPKALTGTADSMCF 323 Methanococcus m...
WP_013413571 194 DVSSAVGDMGVLVTAVTLAGILDYYTVGTKIIPAPKEMVEKQIIMTLNTIASLVESSGIEGLIKILDPKMIVKCAKSMLL 273 Methanothermus ...
WP_015284885 195 DVSAAVSDMGSLVTAVTVSGIIDYFDVGINVIKAPPEMVEKQILLTLQTIASLVETSGVNGMLKAINPELLVKSARSMHI 274 Methanoregula f...
O27556       198 DVSSAVADMGSLVTAVTLSGVLDYYYVGTQIIRAPKEMVEKQILMTLQTIASLVETSGVNGMLKAMNPELLVRSAKSMHL 277 Methanothermoba...
Q6LWJ3       195 DVSATVSDMGSLLTAVTLAGVLDYYSVGTKVIKAPKKMVEQQILMTLQTMASLVESSGVDGLVKALNPELLSKAASSMHL 274 Methanococcus m...
6HUY_C       277 DKNEQPLT 284 Desulfurobacterium thermolithotrophum DSM 11699
Q58125       275 DERQEDLN 282 Methanocaldococcus jannaschii DSM 2661
WP_013413427 274 -PGNTLLP 280 Methanothermus fervidus
WP_013329929 324 GPIAEILP 331 Methanolacinia petrolearia
3F46_A       324 GPLAEILP 331 Methanocaldococcus jannaschii
Q6M0Z1       324 GPLADILP 331 Methanococcus maripaludis S2
WP_013413571 274 KDDQEELK 281 Methanothermus fervidus
WP_015284885 275 REGQGELD 282 Methanoregula formicica
O27556       278 LEEQEELD 285 Methanothermobacter thermautotrophicus str. Delta H
Q6LWJ3       275 LDQQKDLD 282 Methanococcus maripaludis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap