5FIH


Conserved Protein Domain Family
Glyco_hydro_72

?
pfam03198: Glyco_hydro_72 
Click on image for an interactive view with Cn3D
Glucanosyltransferase
This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
Statistics
?
PSSM-Id: 397351
Aligned: 11 rows
Threshold Bit Score: 481.106
Threshold Setting Gi: 2494678
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5FIH_A    25 SSGVSFEKTPAIKIVGNKFFDSES-------GEQFFIKGIAYQLQRSeeelsnangafeTSYIDALADPK--ICLRDIPF 95  baker's yeast
O13692    18 RLALADSASSAIKIKGNAFFNSDT-------NERFYVRGVDYQPGGS------------STLVDPLADTS--ICKRDLPY 76  Schizosaccharomyces...
Q9Y7Y7    17 IFLKATAQTHPIVIKGNAFFDSKT-------NERFYIRGVDYQPGGS------------SSLVDPLAS-R--SCKKDVEI 74  Schizosaccharomyces...
Q08271    15 LVVLCEASVHTIQIKDKHFVDTVT-------GKPFFIKGVDYQPGGSsd---------vSEKQDPLSNPD--ACARDILL 76  Saccharomyces cerev...
Q9USU5    13 SASAAFAYFEPLTIKGRKFF--KN-------DTQFYIKGVAYQPAVDae--------etSTIVDPLAEVNykNCTEDAKI 75  Schizosaccharomyces...
Q03655    14 ATPSLVNAMLPIHIKNYRFIKPSSatnsesdNEVFFVKGVDYQPGGSsgy-------daDSDTDILSDPE--VCARDAYA 84  Saccharomyces cerev...
P22146    17 AGVATADDVPAIEVVGNKFFYSNN-------GSQFYIRGVAYQADTAnet-------sgSTVNDPLANYE--SCSRDIPY 80  Saccharomyces cerev...
EMG48192  18 aaAKFESATPPIEVVGNKFYYSNN-------GTQFLLRGIAYQQDTSgsvsngydsdpnRKYNDPLADAD--ACKRDVQY 88  Candida maltosa Xu316
EMG45991  17 iTSAAAEDLPPIEIVGNKFFYSNN-------GSQFYIKGIAYQQNNLds---------nSTFVDPLANAD--NCKRDIPY 78  Candida maltosa Xu316
P0C7S9    21 PSIKARDDVTPITVKGNAFF--KG-------AERFYIRGVDYQPGGS------------SDLADPIADAD--GCKRDIAK 77  Aspergillus fumigat...
Q08193    19 AASSSNSSTPSIEIKGNAFFNSES-------GERFYIRGVDYQPGGS------------SNLTDPLADAS--VCDRDVPV 77  Saccharomyces cerev...
5FIH_A    96 LKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEP--DISINRENP--SWDVHIFERYKSVIDAMSSFPNLLGY 171 baker's yeast
O13692    77 LQGLNINTIRVYQVDNSANHDECMSALQDAGIYVILDLATS--SNSISRLDAasSYNAVFLQGIFATIDAFKNYTNVLGF 154 Schizosaccharomyces...
Q9Y7Y7    75 FKKLGINTVRVYQVDNSADHDKCMNALSEAGIYVILDLNTY--RHSISRAHPalSYNKVYLQHLFATIDAFKGYDNVLGF 152 Schizosaccharomyces...
Q08271    77 FQELGINTVRIYSINPDLNHDACMTMLAMAGIYLILDVNSPlqNQHLNRYEPwtTYNEVYLEHVFKVVEQFSHYNNTLGF 156 Saccharomyces cerev...
Q9USU5    76 ISNLGANVIRVYAVNASLNHDKCMEAFRNESIYVFLDLANP--KTGIDRDTP--TWNTDQFSSYQSVIDTFQKYNNTGAF 151 Schizosaccharomyces...
Q03655    85 FQQLGVNTVRIYSLNPDLNHDKCMTIFNNAGIYAILDVNSGnyGESLNRADPsgTYDSLYLSRVFKFIDAFKNYPNVLGF 164 Saccharomyces cerev...
P22146    81 LKKLNTNVIRVYAINTTLDHSECMKALNDADIYVIADLAAP--ATSINRDDP--TWTVDLFNSYKTVVDTFANYTNVLGF 156 Saccharomyces cerev...
EMG48192  89 FIDTNTNTLRVYAIDPDKDHEECMKIFSDAGIYVIADLSEP--TVSVNRINP--EWNLDLYERYTKVIDNMQEYSNVLGF 164 Candida maltosa Xu316
EMG45991  79 LEQVDTNVIRVYALDVTQDHTECMQMLQDAGIYIIADLSQP--DESINRNDP--QWNLDLFERYTSVVDKFHNYTNVLGF 154 Candida maltosa Xu316
P0C7S9    78 FKELGLNTIRVYSVDNSKNHDECMNALADAGIYLVLDVNTP--KYSINRAKPkeSYNDVYLQYIFATVDAFAGYKNTLAF 155 Aspergillus fumigat...
Q08193    78 LKDLGINTVRVYTVDNSQDHSHCMKLLQENGIYLILDVNTP--TSAISRYDPacSYNADYLQNVFATIDTFADYDNVLGF 155 Saccharomyces cerev...
5FIH_A   172 FAGNQVTNDHTNTF--ASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDV------------KAD 237 baker's yeast
O13692   155 FAGNEVANTAENSA--TTTWVKAALRDAKEYISKNSDRDIPVGYSAADVAEIRVQCADFFACGNSs----------vRAD 222 Schizosaccharomyces...
Q9Y7Y7   153 FSGNEVVNDE-DTT--AITWVKAVTRDVKAYIKKHSDRHIPVGYSAADVAENRLQLAHYFNCGDEs----------eRAD 219 Schizosaccharomyces...
Q08271   157 FAGNEIVNDKRSAQy-SPAYVKELIGTMKNYISAHSPRTIPVGYSAADDLNYRVSLSEYLECKDDdkp-------enSVD 228 Saccharomyces cerev...
Q9USU5   152 FAGNEVVNNASNAP--AVAYVRAAVRDSKNYIKSKKYRTIPVGYAGADIPVVRTELAAYLSCNAtklnn----dtnsETD 225 Schizosaccharomyces...
Q03655   165 FSGNEVINDQSDYAkiDPPYIRAVQRDMKQYISKHANRSIPVGYSAADNTDLRLATFKYLQCNSLdgnkvnddldisKSD 244 Saccharomyces cerev...
P22146   157 FAGNEVTNNYTNTD--ASAFVKAAIRDVRQYISDKNYRKIPVGYSSNDDEDTRVKMTDYFACGDDd----------vKAD 224 Saccharomyces cerev...
EMG48192 165 FAGNEVTNNRTNTD--ASPFVKAAVRDMKKYIKDNDYRTIPVGYSSNDDEDTRVAIADYFACGSLd----------dRAD 232 Candida maltosa Xu316
EMG45991 155 FAGNEVTNNVSNTD--ASAFVKAAIRDTKAYIKAKGYRTIPVGYSANDDSDIRVSLARYFACGDEd----------eSAD 222 Candida maltosa Xu316
P0C7S9   156 FSGNEVINDGPSSS--AAPYVKAVTRDLRQYIRSRKYREIPVGYSAADIDTNRLQMAQYMNCGSDd----------eRSD 223 Aspergillus fumigat...
Q08193   156 FAGNEVINSVNTTN--TATYVKAVVRDMKKYIKARKYRQIPVGYSAADIVANRQLAAEYFNCGDEad---------aRID 224 Saccharomyces cerev...
5FIH_A   238 FYGINMYEWC-GY-STYGTSGYRERTKEFEGYPIPVFFSEFGCNLVR-------PRPFTEVSALYGNKMSSVWSGGLAYM 308 baker's yeast
O13692   223 FYGMNMYEWC-GAdSSFTISGYDQRMEEFANYSIPLFLSEYGCNDVTkesdgtpDRPFDEVDAIFSSEMSSVFSGGLVYQ 301 Schizosaccharomyces...
Q9Y7Y7   220 FYAFNMYEWC-GY-SSMTVSGYYDRIKEFSNYSIPLFLSEFGCNTVEinddttpNRPFTEIEAIYSHDMTPVFSGGLVYE 297 Schizosaccharomyces...
Q08271   229 FYGVNSYQWC-GQ-QTMQTSGYDTLVDAYRSYSKPVFFSEFGCNKVL-------PRQFQEIGYLFSEEMYSVFCGGLVYE 299 Saccharomyces cerev...
Q9USU5   226 FLGYNMYEWC-GH-SDFYTSGYAARTQELENFTIPIFLSEFGCNKVT-------PRVFTEVQAIYSDNMTNVWSGGIVYE 296 Schizosaccharomyces...
Q03655   245 FFGLNTYEWCsGT-SSWESSGYDKLNSTFEDAVIPLIFSEYGCNKNT-------PRTFDEVSEGLYGGLKNVFSGGLVYE 316 Saccharomyces cerev...
P22146   225 FYGINMYEWC-GK-SDFKTSGYADRTAEFKNLSIPVFFSEYGCNEVT-------PRLFTEVEALYGSNMTDVWSGGIVYM 295 Saccharomyces cerev...
EMG48192 233 FFGINMYEWC-GR-STFATSGYKDRTEDFKNLTIPIFFSEYGCNEVS-------PRVFQEVGTLYSDQMTDVWSGGIVYM 303 Candida maltosa Xu316
EMG45991 223 FFGMNMYEWC-GS-SSFKASGYQSATEDYKNLGIPIFFSEYGCNEVT-------PRKFQEVGTLFGSDMTDVWSGGIVYM 293 Candida maltosa Xu316
P0C7S9   224 FFAFNDYSWC-DP-SSFKTSGWDQKVKNFTGYGLPLFLSEYGCNTNK--------RQFQEVSSLYSTDMTGVYSGGLVYE 293 Aspergillus fumigat...
Q08193   225 MFGVNDYSWC-GE-SSFVVSGYSTKMKLYQDYSVPVFLSEFGCNQVKs------SRPFTEIEAIYSTQMSSVFSGGLVYE 296 Saccharomyces cerev...
5FIH_A   309 YFEEENEYGVVKINDNDGVdILPDFKNLKKEFAKAD 344 baker's yeast
O13692   302 YSEEGNNYGLVVIDGDNVT-ISKNYETLKEKYASAA 336 Schizosaccharomyces pombe 972h-
Q9Y7Y7   298 YSAEPNHYGLVVIDKDDERrVSRNFITLMKQYAKTP 333 Schizosaccharomyces pombe 972h-
Q08271   300 FSQEDNNYGLVEYQEDDSVqLLADFEKLKSHYQNIE 335 Saccharomyces cerevisiae S288C
Q9USU5   297 YSQEVNDYGLVNVSSTGERvLTTDYNNLKKQWASIS 332 Schizosaccharomyces pombe 972h-
Q03655   317 YTEEANNYGLVKLDDSGSLtYKDDFVNLESQLKNVS 352 Saccharomyces cerevisiae S288C
P22146   296 YFEETNKYGLVSIDGNDVK-TLDDFNNYSSEINKIS 330 Saccharomyces cerevisiae S288C
EMG48192 304 YYEEANHYGLVSLNGDKVS-TLADYNNYKSAIKSIS 338 Candida maltosa Xu316
EMG45991 294 YFQEENNYGLVSVSGSSVS-TLQDFNNYKSEILDIs 328 Candida maltosa Xu316
P0C7S9   294 YSQEASNYGLVEISGNNVK-ELPDFDALKTAFEKTS 328 Aspergillus fumigatus Af293
Q08193   297 YSNETNNYGLVQIDGDKVT-KLTDFENLKNEYSKVS 331 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap