Conserved Protein Domain Family
LOB

?
pfam03195: LOB 
Lateral organ boundaries (LOB) domain
The lateral organ boundaries (LOB) gene encodes a plant-specific protein of unknown function that is expressed at the adaxial base of initiating lateral organs. The N-terminal of the LOB protein contains an approximately 100-amino acid conserved domain (the LOB domain) that is present in 42 other Arabidopsis thaliana proteins as well as in proteins from a variety of other plant species. The LOB domain contains conserved blocks of amino acids that identify the LOB domain (LBD) gene family. In particular, a conserved C-x(2)-C-x(6)-C-x(3)-C motif, which is the defining feature of the LOB domain, is present in all LBD proteins.
Statistics
?
PSSM-Id: 397350
Aligned: 151 rows
Threshold Bit Score: 66.3547
Threshold Setting Gi: 122222100
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WGS:AAAA:OsI_03908  39 CGACKFLRRRCVPGCVFAPHF-----SGcggsgvgagvggrgreRGAAEFAAVHRVFGASNVAKLLsRV-PAALRRDAAR 112 long-grai...
XP_009397285         3 CNGCRVLRRGCSATCILRPCIqcidgAG----------------AQAHATAFVAKFFGRSTLLSFLsSVp-LPRRPAAFR 65  wild Mala...
XP_002987125         3 CNGCRVLRKGCSDSCILRPCLqwiegPE----------------AQGHATVFVAKFFGRAGLMNFIsAVp-ENQRPALFQ 65  Selaginel...
XP_006362058         3 CNGCRVLRKRCSDNCTLRSCLdgiddPQ----------------AQGNATLFVSKFFGRSDLMSLIaAVp-QNRRPDLFK 65  potato
AOF43371             3 CNGCRVLRKGCSETCVLRSCLhwiptPE----------------AQGNATLFLAKFFGRSDLISLIsAVp-ESQRPVLFQ 65  black cot...
XP_006346321         3 CNGCRILRKGCNENCILRQSLqgiesPH----------------AQANATVFVAKFFGRAGLMSFLtSVs-ESQRPALFQ 65  potato
XP_002527499         3 CNGCRILRKGCSEDCMLRHCLqfidnPQ----------------AQANATVFVAKFFGRAGLMSFIsSVp-YNQRPSLFQ 65  castor bean
XP_003535688         3 CNGCRVLRKGCSDDCMLRHCLlwienPQ----------------AQAHATLFVTKFFGRATLMSFLsTVp-PNQRSALFE 65  soybean
XP_006341223        10 CAPCKYQNNICDENCPLAPFF-----PS----------------NKVDEFDKVIRLYSIDTLINMLnSVtANEKKAKMAE 68  potato
XP_002875413         6 CRFCRLQNKQCVNDCMFSPLF-----PS----------------NNLRKFTIMNFVFGHKTLTFFLkDL-SPMDRKYTTR 63  Arabidops...
WGS:AAAA:OsI_03908 113 TVCYEAQARIADPVYGSVGTILALQHQVSLLQGQLSVLES 152 long-grained rice
XP_009397285        66 SLLYEACGRTINPVTGATGLLWTGNWHLCQAAVATvlggg 105 wild Malaysian banana
XP_002987125        66 SLLYEACGRTVNPVFGAVGLLWSGSWHVCQAAVETVLKgg 105 Selaginella moellendorffii
XP_006362058        66 SLLFEACGRTMNPVTGAVGLLSTGNWHVCQKAVQTVLAGg 105 potato
AOF43371            66 SLLFEACGRTVNPVNGAVGLLWSGNWHVCQAAVESVLAGE 105 black cottonwood
XP_006346321        66 SLLFEACGRTVNPVHGAVGLLWTGNWHVCQSAVETVLKgg 105 potato
XP_002527499        66 SLLYEAVGRAVNPVSGAVGLLWTGNWHVCQKAVMTvlrgg 105 castor bean
XP_003535688        66 SLLYEAVGRTINPVNGAVGLLWTGNWHLCQMGVEKVLrgg 105 soybean
XP_006341223        69 TLILEAKIRYENPVYGSLAVIEKLNLEIEETQKELDLVQK 108 potato
XP_002875413        64 TLYFEAKSWFFGPSKDPSDFLNAVINYANQTLAELSKTKK 103 Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap