Conserved Protein Domain Family
Thioredox_DsbH

?
pfam03190: Thioredox_DsbH 
Protein of unknown function, DUF255
Statistics
?
PSSM-Id: 397347
Aligned: 81 rows
Threshold Bit Score: 225.104
Threshold Setting Gi: 123741535
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q30S56          2 SNRLQKEDSPYLQQHKDNPVDWYPWCDEAFKKAKDENKAIFISIGYSSCHWCHVMEENVFENQECADILNKHFISIKVDR 81  Sulfurimonas d...
jgi:Exig_2546   3 TNRLINEKSPYLLQHATNPVDWYPWGEEAFAAARSANKPIFLSIGYSTCHWCHVLAHESFEDEETARMLNDRFISIKVDR 82  Exiguobacteriu...
Q2S805         34 TNHLILESSPYLLQHAHNPVNWRAWNDDTFALAKAENKPIFLSIGYSTCHWCHVMEEESFDNEEVAQTLNGYFIPIKVDR 113 Hahella chejue...
Q6LJK5         58 TNRLILENSPYLLQHAHNPVNWYAWGKEAFDAARRENKPIFLSIGYSTCHWCHVMEAESFDNEEVARILNKYFISIKVDR 137 Photobacterium...
Q186C3          7 PNNLINEKSPYLLQHAYNPINWYSWNDEAFKKAKEEDKPIFLSVGYSTCHWCHVMEKESFEDEEVAEIMNRNFVAIKVDK 86  Clostridioides...
O84360          8 TNKLITEKSPYLLLYAHTPVDWYPWSAEAFQKASAEDKPIFLSIGCTHSKWCQVMLKENYENPEVAAILNEYFVCIKVDK 87  Chlamydia trac...
EGZ78058       84 RNRAAESQSPYVRVHAKTPVAWQLLNADTLKRAQAENKPIFMHIGFLADH-------HSFANNAVAAFLNSSFIPVIIDR 156 Neurospora tet...
Q0V393         20 KNRLNESRSPYVRGHMNNPVAWQQWGPEALELAKKSNRLIFISIGYAACHWCHVMERESFENQEVADILNKNFIPIKIDR 99  Parastagonospo...
XP_752606      17 vNRLRDSRSPYVRAHMNNPVAWQLWDAEAIELARRYNRLIFLSIGYSACHWCHVMEKESFMSQEVASLLNESFIPIKVDR 96  Aspergillus fu...
Q9HJH7          2 PNELSRSLSPYLLMHANDPVEWRMWSKETLRIATEENRLIFLSIGYSSCHWCHVMHEESFVDPDVAEILNNNYIPVKVDR 81  Thermoplasma a...
Q30S56         82 EERPDIDKHYQEVYMLLNrRAG------GWPTSIFCTPHNKPFFAGTYIA----PQ-----TREgsiEG----------- 135 Sulfurimonas d...
jgi:Exig_2546  83 EERPDIDQIYMTAAQMMN-GQG------GWPLSVFMSPDQTPFYIGTYFP----KT-----PQF---NR----------- 132 Exiguobacteriu...
Q2S805        114 EQRPDLDEIYMTAVQIIT-GHG------GWPMSSFLTPEGNPFFGATYFP----R------------------------- 157 Hahella chejue...
Q6LJK5        138 DLRPDIDDFYIKAALVFS-GKA------GWPVSSFLTHDSKPFFVASYF------------------SR----------- 181 Photobacterium...
Q186C3         87 EERPDVDSVYMTVCQAMT-GSG------GWPMTIIMTPDKKPFFAGTYFP----KY-----SRY---NR----------- 136 Clostridioides...
O84360         88 EELPHLANLYFELSQMLS-VSGevqdspTWPLNVFLTPNLLPFFSLGYAS----FA-----GKM---GA----------- 143 Chlamydia trac...
EGZ78058      157 DERPDLDTIYQNYSEAVN-ATG------GWPLNLFLTPDLYPIFGGTYWP----GP-----GTE---HSlaaarggasgv 217 Neurospora tet...
Q0V393        100 EERPDIDRIYMNYVQATT-GGG------GWPLNAFITPDLEPIFGGTYWPgpesTM-----AME---GH----------- 153 Parastagonospo...
XP_752606      97 EERPDIDDVYMNYVQATT-GSG------GWPLSVFLTPNLEPVFGGTYWP----GPnsstlSRQ---DT----------- 151 Aspergillus fu...
Q9HJH7         82 EERPDLDSYFMKVSQVIN-GNG------GWPLNIILLPDARPVFAMTYVP----KE-----DRN---GM----------- 131 Thermoplasma a...
Q30S56        136 --------------------MGFIELTKLIADKISSN--DEQLFKNADEIENFLN 168 Sulfurimonas denitrificans DSM 1251
jgi:Exig_2546 133 --------------------PSFRQVLLQLSEHYRTD--PDKIKRVGQEIIQALT 165 Exiguobacterium sibiricum 255-15
Q2S805        158 --------------------PRFINLLRKVHELWEEQ--QENLLEQGRRLSEAVS 190 Hahella chejuensis KCTC 2396
Q6LJK5        182 --------------------PDFVDLLEQVQDKWTNN--HQFLLKSAIEIYQEIQ 214 Photobacterium profundum
Q186C3        137 --------------------PGVIDLLENVSEKWNTS--RDILIKSGDEIIEALK 169 Clostridioides difficile 630
O84360        144 --------------------SSFVQMLEKLHIMWEDRedREVFVQQAERVLevaa 178 Chlamydia trachomatis
EGZ78058      218 gggaatpevssingggeesyNDFLAIAKKIHKFWVEQ--EERCRREAFEMLHKLQ 270 Neurospora tetrasperma FGSC 2509
Q0V393        154 --------------------PGFVGILEKIRDVWQNQ--RQRCLDSAKEITAQLR 186 Parastagonospora nodorum SN15
XP_752606     152 --------------------VGFVDILEKLRDVWKTQ--QQRCLDSAKEITRQLr 184 Aspergillus fumigatus Af293
Q9HJH7        132 --------------------TGLKTILIQLSQMYLKD--PDQFKDQAKAVSDAME 164 Thermoplasma acidophilum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap