1XRI,6E3B


Conserved Protein Domain Family
Y_phosphatase2

?
pfam03162: Y_phosphatase2 
Click on image for an interactive view with Cn3D
Tyrosine phosphatase family
This family is closely related to the pfam00102 and pfam00782 families.
Statistics
?
PSSM-Id: 397328
Aligned: 8 rows
Threshold Bit Score: 164.077
Threshold Setting Gi: 140556
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XRI_A   2 LIPPLNFSXVDN---GIFRSGFPDSANFSFLQT-LGLRSIIYLCPEpYPESNLQ--FLKSNGIRLFQFGIEGNKEP---- 71  thale cress
P50946  67 IVPPLNFCPVER---YLYRSGQPSPVNFPFLLN-LKLKTIIWLSNE-EPQDTLLe-FCDTHRINLQFAAINPDAGEdd-- 138 Saccharomyces cerevis...
Q12454   3 LVTPLQFSTVQP---NLYRGSYPREINLPFLRT-LRLKYILSLTPEpLSTDPLMvkFCEENNIKTIHIKCQSERKAdktk 78  Saccharomyces cerevis...
Q9U0Z9 398 LVPPFRFARVES---GVYRGAYPVLRNFPYIRR-LRLRTMVSLIPEpPTYDLKC--FAEAEHIQLHHIHAERAKG----- 466 Leishmania major
Q9UUF3  80 PLVPDNFGVVYPg--IIYRSACPRASNFNFLES-LHIRTIISLRQEeYSEEDLH--YFTKHHINYYHIAMPGSKHRkndc 154 Schizosaccharomyces p...
6E3B_W   4 VIPPENFSHVVG---EIYRSSFPRQENFSFLHErLKLKSILVLIPEeYPQENLN--FLKLTGIKLYQVGMSGNKEP---- 74  baker's yeast
P25366  62 VLRMSDFSAAAV---PVKSSSVSNANLYSNNNStLSLQEEKKKSTAnGSQNSTT--G-DPVIQEELAYHLTDNDD----- 130 Saccharomyces cerevis...
P53949   3 YIPPLNFSPVVStdvSLYRSGYPMPLNYSFIKHqLHLKTIIYIGDKdRPLEEYQs-FLESEKIKYYHIFMDSSRD----- 76  Saccharomyces cerevis...
1XRI_A  72 --------FVNIPDHKIRXALKVLLDEKNHPVLIHCKRGKHRTGCLVGCLR-KLQKWCLTSIFDEYQRFAAA-KARVSDQ 141 thale cress
P50946 139 ------npWDGLTEHSIINVLQTIVTQENYPLLVCCGMGRHRTGTVIGCLR-RIMGWNLASVSEEYRRFTGSrGGRILVE 211 Saccharomyces cerevis...
Q12454  79 pkikrkkkTVPIEYDVVVRCVKFLIDKGHYPCYMHCTNGELIISLVVACMR-KFSYWSTVSILNEFLVYNSS--INIHER 155 Saccharomyces cerevis...
Q9U0Z9 467 --------EVQLLPSELSEALQLIMNKDMHPLYIHCLDGRHVTGLVIMALR-KLLQWDANVANAEFQRFTRE---VQDEA 534 Leishmania major
Q9UUF3 155 is-sssnpDISDVDDLVRKTLQLLLNKENWPVLLHCSRGKHRTGIVIGCLR-ALMNWPVGNRLQEYISFSHP-KEREVDE 231 Schizosaccharomyces p...
6E3B_W  75 --------FVNIPSHLLTKALEIVLNPANQPILIHSNRGKHRTGCLIGCIR-KLQNWSLTMIFDEYRRFAFP-KARALDQ 144 baker's yeast
P25366 131 --------LMLIKSTCLKRTFKTLLNVDNYNVLLVD-----KTALVIGILR-KIQKWNIASIINEYRLFSGK-NRNYFAE 195 Saccharomyces cerevis...
P53949  77 ----------EGIQERMNQVLHLVLDVRNYPILVHSNKGKHRVGVVVGIIRkLLQGWSTAGICQEYGLFSGG-MKDGVDL 145 Saccharomyces cerevis...
1XRI_A 142 RFXEIFDVSS 151 thale cress
P50946 212 LLIEAFDTNL 221 Saccharomyces cerevisiae S288C
Q12454 156 NFIENFNSEI 165 Saccharomyces cerevisiae S288C
Q9U0Z9 535 AFIADYTGPL 544 Leishmania major
Q9UUF3 232 EYIQNFSSDP 241 Schizosaccharomyces pombe 972h-
6E3B_W 145 QFIEMYDDDE 154 baker's yeast
P25366 196 TFLEIINIEI 205 Saccharomyces cerevisiae S288C
P53949 146 EFITMFETNL 155 Saccharomyces cerevisiae S288C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap