2AKW


Conserved Protein Domain Family
FDX-ACB

?
pfam03147: FDX-ACB 
Click on image for an interactive view with Cn3D
Ferredoxin-fold anticodon binding domain
This is the anticodon binding domain found in some phenylalanyl tRNA synthetases. The domain has a ferredoxin fold.
Statistics
?
PSSM-Id: 397318
Aligned: 100 rows
Threshold Bit Score: 77.1336
Threshold Setting Gi: 122285580
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AKW_B       688 SRHPAAFRDLAVVVPAPTPYGEVEALVREAAGPYLESLALFDLYQGPPLP-EGHKSLAFHLRFRHPKRTLRDEEVEEAVS 766 Thermus thermop...
Q1ITS7       578 SRYPAVERDFSFVFDDAVTFDRVREAVEALGITEMTSFQAVEIFRGGSVP-AGKYSFLVRAAFQSAERTLRDEEVANWSG 656 Candidatus Kori...
P59505       703 SLYPRCSRDISIIVNDSIAADEILKVSKNVFLDKIVEVKLFDVFYGKNVG-LNKKSLSLRFIFGSSKRTLSEEIISNCLN 781 Buchnera aphidi...
Q057Y9       702 STLPISKRDISIIISDKIIVKDIIDLCNKNIYIKNSEIYVYDIYTGSNVP-SGKKSISICFLFNSLQSMLKESDININIL 780 Buchnera aphidi...
Q8D3B5       707 SDIPFNYRDISIVISNKIPIIEVIKICKDSIKKELININIFDIYQGKEIK-KGHKSISIRLTLQNKNYNMTNLEINSILE 785 Wigglesworthia ...
Q6F166       701 SKFQKSTRDISFELSNDVNFDTIVKAMLKDL-NYLTNYKVIDKYSDEQMDkENISSLTVKLSFNSLDHQLTEKEINDDFE 779 Mesoplasma flor...
Q6MT18       702 SKFQSSSRDLTIEISNDLTYQKVLFNALSDV-KYLKSHKIVDLYLDDNLIkNNTKALTIQFVFNDLEHQLTENEINQEFE 780 Mycoplasma myco...
BAF69774     684 SVYQRSLKDLSVVVDRTLPYESIKTVLEKNLPKEVRNFYPVDIYEDESLG--DKKSVTIRFAIQSFEKTLTEEEISKILE 761 Nitratiruptor s...
BAF71507     685 SKFQGVYKDLSIVIDKSLSYYEVAKVLNGLDIPTLKESYPVDIYEDEKLG--NKKSLTIRFFIQSMEKTLEDSDIEAVMA 762 Sulfurovum sp. ...
WP_015924941 701 SKYPEVLLDYSFLVDNSVTFDKLMQDIGAFKSDVLNGFEFVTIYNGKGLP-EGKKSMTFRFVIGSAEKTLSSEDINAFAN 779 Ruminiclostridi...
2AKW_B       767 RVAEALRAR-GFGLR 780 Thermus thermophilus HB8
Q1ITS7       657 QIIKAL-EIlGGALR 670 Candidatus Koribacter versatilis Ellin345
P59505       782 ECIRILQEKfNAILR 796 Buchnera aphidicola str. Bp (Baizongia pistaciae)
Q057Y9       781 QCISALKDKfGAILR 795 Buchnera aphidicola BCc
Q8D3B5       786 KCICNLKKNfLIEIR 800 Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
Q6F166       780 KILNNL-KElKVKVR 793 Mesoplasma florum L1
Q6MT18       781 KIIKNI-KQmKVVIR 794 Mycoplasma mycoides subsp. mycoides SC str. PG1
BAF69774     762 KILKILQEEiGATLR 776 Nitratiruptor sp. SB155-2
BAF71507     763 EVMQALETNcNAELR 777 Sulfurovum sp. NBC37-1
WP_015924941 780 SLLDYMAEK-GYTLR 793 Ruminiclostridium cellulolyticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap