1V9P


Conserved Protein Domain Family
DNA_ligase_OB

?
pfam03120: DNA_ligase_OB 
NAD-dependent DNA ligase OB-fold domain
DNA ligases catalyze the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilising either ATP or NAD(+) as a cofactor. This family is a small domain found after the adenylation domain pfam01653 in NAD dependent ligases. OB-fold domains generally are involved in nucleic acid binding.
Statistics
?
PSSM-Id: 397300
Aligned: 475 rows
Threshold Bit Score: 86.6499
Threshold Setting Gi: 123777855
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V9P_A       322 ETRLLDVVFQVGRTGRVTPVGVLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGEE 400
B9L8R4       315 ETIIEDVIVQVGRTGVLTPVAVLKPVEIGGVIVERATLHNFDEIERMDIRIGDHVIVIRSGDVIPKITKVLTWKRKGDE 393 Nautilia profund...
WP_013553608 313 QTRLLDVIPQVGRTGVITPVAVLEPVEIEGVVVERATLHNYDYIEKLDIRIGDMVTVIRSGDVIPKIIKVLPQYRTGKE 391 Nitratifractor s...
Q7M8A0       311 KARLLSITLQVGRSGVVTPVANLEPVEIEGAMISRATLHNFDEIKRLDVREGDWVSLIRSGDVIPKIIQPFAHLRSGEE 389 Wolinella succin...
EFR46772     311 sSKILDITLQVGRTGIITPVAELEPVEIEGAMIARATLHNFSEIERKDIRINDEVIIIRSGDVIPKIIKPITALRDGTQ 389 Helicobacter cin...
O25336       313 HTKIVGVINQVGRSGAITPVALLEPVEIAGAMINRATLHNYSEIEKKNIMLSDRVVVIRSGDVIPKIIKPLESYRDGSQ 391 Helicobacter pyl...
WP_013468951 312 HTRLLEVIAQVGRSGAITPVARLEPVNLDGAQIARATLNSYTDIQQKDLQLNDMVVVLRSGDVIPQVIKPLVHLRDGSQ 390 Helicobacter felis
CCB80433     149 HTRLLGVLPQVGRSGVVTPVALLEPIELEGATISRATLHNYTEVQKKGICLNDVVVVVRSGDVIPKIIKPLTHLRDGTQ 227 Helicobacter biz...
CBG40040     330 fTKILSIINQVGRTGVITPVAELEPIEIEGARVTRATLHNYKEIQKKDIRIFDEVVVIRSGDVIPKIIRPNIARRTGEE 408 Helicobacter mus...
WP_006655411 310 KAKILDIVLQVGRTGVITPVAILEPVMIEGAKVSRATLHNFDEIKKKDILINDSVILIRSGDVIPKIIKSLPTLRDGTQ 388 Helicobacter can...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap