5I2D,4NOI


Conserved Protein Domain Family
RNA_pol_A_CTD

?
pfam03118: RNA_pol_A_CTD 
Click on image for an interactive view with Cn3D
Bacterial RNA polymerase, alpha chain C terminal domain
The alpha subunit of RNA polymerase consists of two independently folded domains, referred to as amino-terminal and carboxyl terminal domains. The amino terminal domain is involved in the interaction with the other subunits of the RNA polymerase. The carboxyl-terminal domain interacts with the DNA and activators. The amino acid sequence of the alpha subunit is conserved in prokaryotic and chloroplast RNA polymerases. There are three regions of particularly strong conservation, two in the amino-terminal and one in the carboxyl- terminal.
Statistics
?
PSSM-Id: 397298
Aligned: 61 rows
Threshold Bit Score: 57.5537
Threshold Setting Gi: 122252813
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5I2D_L        246 PEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEE---IKEALEK 308 Thermus thermophilus HB8
Q7UPA4         15 RLRRERLDLSIAEMGLTVRTTNCLEETGILTVRDLLNATPRRLLKISNFGEKTLEE---VYDALEQ 77  Pirellula sp.
Q01V32         14 DPKIVSLESAVEDLGLSVRTRNALRAIGCDTVENVLALDLGS--SVRGLGRKTKEE---LLVALEL 74  Candidatus Solibacter usitat...
Q1IX99        262 PADLDTPRVTLEGLGLTTRVLHSLKEEGIDSVDALCALSDRDLKKVPGIGERSLDE---IKQQLAQ 324 Deinococcus geothermalis DSM...
jgi:Amet_2144  88 HDGLKYIDIAIENLNLSVRAFNCLKSTSVDYYSQLIDVLDEELIAIPNMGRKTLLElehIKKTVQP 153 Alkaliphilus metalliredigens...
EAW45063      241 D---PTAQIPIEELQLSVRAYNCLKRAQVNSVADLLDFTQEDLLEIKNFGQKSAEE---VVEALQR 300 Nodularia spumigena CCY9414
A0T0K0        245 E---PYTNIAIEELQLSVRAYNCLKKAQINTVGDLLQYSPEKLQELKNFGRKSADE---VFSTLKN 304 Phaeodactylum tricornutum CC...
BAC85013      377 V---DLRHVYVDQLRIPSKAYNSLKRANINTVSDLLDYTQDDLLSIPNFGRKSVDD---ILEALQA 436 Physcomitrella patens
Q0P3L0        289 S---NFDQIFIEQLELSLRAYNCLKRANILTLADLSQQSFRDLMKLRNFGQKSADE---VRAALST 348 Ostreococcus tauri
Q9PQN4        260 R---QNASISIDDLDLTVRAYNALKQSGINTTAELIELTKSQLEKIKNLGRKSVTE---IIQKLTE 319 Ureaplasma parvum serovar 3 ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap