4P6V


Conserved Protein Domain Family
NQR2_RnfD_RnfE

?
pfam03116: NQR2_RnfD_RnfE 
NQR2, RnfD, RnfE family
This family of bacterial proteins includes a sodium-translocating NADH-ubiquinone oxidoreductase (i.e. a respiration linked sodium pump). In Vibrio cholerae, it negatively regulates the expression of virulence factors through inhibiting (by an unknown mechanism) the transcription of the transcriptional activator ToxT. The family also includes proteins involved in nitrogen fixation, RnfD and RnfE. The similarity of these proteins to NADH-ubiquinone oxidoreductases was previously noted.
Statistics
?
PSSM-Id: 397297
Aligned: 473 rows
Threshold Bit Score: 116.356
Threshold Setting Gi: 328448535
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4P6V_B           40 VTKRSSHVRDSV-DLKRIMIMVWLAVFPAMFWGMYNAG----GQAiaalnhlysgdqlaaivagnwhywltemlggtmss 114
CCX67174          8 VFETAPYVRSRI-TTGDLMYFVVLALLPCAGMGIYRYG----FHA----------------------------------- 47  Firmicutes b...
CDD02047          6 ssMHAPYVRMGR-GSYRVMCDVLIAMIPPIVWAVYVFG----GRA----------------------------------- 45  Ruminococcus...
CCY91197         11 saesAAKARSEIsITRRYFADMLILMVVPAVMAWYYYG----GRA----------------------------------- 51  Eubacterium ...
WP_022132922      4 LRHHAPYIRHPE-SSRTVMSDAVIALVPLYFMSYFYYG----SRV----------------------------------- 43  Negativibaci...
CDA62709          4 SLHHAPYIRHPE-SCRTIMGDTLISLLPLYFMSYFYYG----PRV----------------------------------- 43  Clostridium ...
WP_015711641     12 lQSQKPQVNLAR-PTVGRMWLVSLCAFMAVIQSSLSDG----FFS----------------------------------- 51  Treponema az...
jcvi:TREPR_1747  14 qpfqKPQINLAR-STSARMWLVSICAGFTILQSSLTDG----FSS----------------------------------- 53  Treponema pr...
AEB14251         12 kitlNPFA-----SASYSLGTISFVMIALLLVQVAMLAvsksFDS----------------------------------- 51  Treponema su...
Q73MW5            8 sLTAAPFVYTRL-PIFKINIVVLSLLGIQILILALSAD----LYA----------------------------------- 47  Treponema de...
4P6V_B          115 dagwgskmllgatyfLPIYATVFIVGGFWE---VLFCMVRKHEV------NEGF--FVTSILFALIVPPTLPLWQAALGI 183
CCX67174         48 ---------------ALLIGISVGCAFVLE---FLCDLIWKKRAas--vmDYSC--IVTGLVCGLILPPGAPLWAAAAQS 105 Firmicutes b...
CDD02047         46 ---------------VTMIVVGVTFASAAD---YSFRRFIFRKGnd---fDVSA--AVTGILIGFALPVSAPLWLPAFAA 102 Ruminococcus...
CCY91197         52 ---------------VRLMVLSVLTAVLCE---AAGSFIFKAQAsv---sDLSA--VATGLMTSLCMPASAPYYLPCIAS 108 Eubacterium ...
WP_022132922     44 ---------------LFVGAFSALLCLACD---WACNYLLYRRInf---rDLSA--LVTGIIISMLMPPTIDFYVVAAAC 100 Negativibaci...
CDA62709         44 ---------------LVIGAVAVLTCLAAD---WLCSYLTYRRVnl---rDLSA--AVTGVIISMLMPPAIDLTVIVVAS 100 Clostridium ...
WP_015711641     52 ---------------LLIAFSAVAAALLAE---FLILYQSGRASql---kNGSA--VATALILALLLPNTISPIYAILGA 108 Treponema az...
jcvi:TREPR_1747  54 ---------------MFIALFAVLGALMAE---LLISHVSGRTIpgavfqDGSA--VASALILTLLLPNHIHPFLAFLGA 113 Treponema pr...
AEB14251         52 ---------------LVVLLFALLASVCAEaafYFFKRTEKHTWri---------sVIQGLIAGLLIPSVYPVYAVFAVV 107 Treponema su...
Q73MW5           48 ---------------LLNIVIAVMGVLFVE---NLLRYLASSKF------GLSLemIISGLLIGFFMPTGIGFVFVFILS 103 Treponema de...
4P6V_B          184 TFGVVVAKEVFGGTGRNFLNPALAGRAFLFFAYP----AQI-------------SgdlvwtaaDGY-----------SGA 235
CCX67174        106 ALAIVVFKHASGGLGHNLFNPAMAAKCVLLLVCR----GMM-------------L--------DLSck-------nyEGV 153 Firmicutes b...
CDD02047        103 LVAICV-KYSAGGIGKNLFNPAASGICVSYLLFG----KNM----------------------TVFtkpfaslpafaLSV 155 Ruminococcus...
CCY91197        109 AFAVIVAKLPFGNARSHMFTPAAAGIAFVTICMP-----------------------------DKVfsypamlssgtTAV 159 Eubacterium ...
WP_022132922    101 LFAILVTKAPFGGTGHNVFNPAAAGLAFATLCWS----SKMfqyvqplqklpftI--------DES-----------VSI 157 Negativibaci...
CDA62709        101 LFAILVCKAPFGGTGHNIFNPAAAGVAFAIICWN----PQMfaytqplqrlpvtI--------DQT-----------VTL 157 Clostridium ...
WP_015711641    109 VFAIAVVKHSFGGLGANWLNPAAGGWLFIRLASPgafgKAL------------------------------------EGS 152 Treponema az...
jcvi:TREPR_1747 114 LFAMLVVKHSFGGLGTNWVNPALGGWLFVRFGWPgafnAAL------------------------------------EGS 157 Treponema pr...
AEB14251        108 FFTLLLGKFVFGNFDSSWANLVALCIVVLYFLNP----SAFppfa---------------vsaQELqtrnaalsliqNGT 168 Treponema su...
Q73MW5          104 AFSVFIVKTVFGGTGRNWLNPVAFAVCAAYISRP----EAFppli---------------sdfSLLaekgsffavmeANG 164 Treponema de...
4P6V_B          236 -----------T--ALSqw----------------------------------------------aQGgagalinnatGQ 256
CCX67174        154 -----------S--PLA-------------------------------------------------LLq--------sGE 163 Firmicutes b...
CDD02047        156 pdavlneygvaT--SLDl-----------------------------------------------mRDg--------kVV 178 Ruminococcus...
CCY91197        160 sggqgffpgtsIayMLSq-----------------------------------------------kNSv--------gTG 184 Eubacterium ...
WP_022132922    158 lqgptatlklgGipRLG--------------------------------------------------------------- 174 Negativibaci...
CDA62709        158 lqgptatlklgGipRLG--------------------------------------------------------------- 174 Clostridium ...
WP_015711641    153 --------------PLSllaeslsrgfanpqgsplgilkidsggvfaqasnldtvirsffndtvfsLTg--------aEL 210 Treponema az...
jcvi:TREPR_1747 158 --------------SLGvltnslnagaahgspleiinaga----eifapgtldsiltpflnktifsITg--------aEL 211 Treponema pr...
AEB14251        169 vplleldssitD--FLNsyi--------------------------------------------fkFFg--------iSI 194 Treponema su...
Q73MW5          165 llklktdftitS--ALNsil--------------------------------------------lhGVg--------vTL 190 Treponema de...
4P6V_B          257 TITWMDAFIG--NipGSIGEVSTLALMIGAAFIVYMGIASWRIIGGVMIGMILLSTLFnvigsdtNAMFnm------pWH 328
CCX67174        164 TPNLLEMLTGnvA--GYIGTASALAVLAGVVILFLAGIIDLTVPLAAILSFSVCYVLI-------GRYGlsp----ytLA 230 Firmicutes b...
CDD02047        179 TSSIADYFYGieA--GAIGAVSAALLTVSLIYLLIRRVSGVGALAGYLMGMLVLTFFT-------AYADcep---idfAA 246 Ruminococcus...
CCY91197        185 LLNYVDVLVGsvS--GPMGATCSIALFGALLFLAVRRPKNFTVSVSFLAVCFIYALLF-------PRVLtgr---fvsAF 252 Eubacterium ...
WP_022132922    175 ---LTELLLGnfP--GTIGSTYTLIIFACLIYLIARNAAKWYLTLSYLIPVALLSAVN-------HPYGvdp---lesIA 239 Negativibaci...
CDA62709        175 ---LTELFLGnfP--GPLGSTYTLIIFAGLVYLIARNLAKWYTTLSFLLPIAVLSAIN-------HPYGvsp---lesIA 239 Clostridium ...
WP_015711641    211 PGGYLDLFAAgaP--GIIADRGVLALLAGTIIITATQVNRAWIPAVWLGVFAFLVRLA-------GAFVfggawwggdMI 281 Treponema az...
jcvi:TREPR_1747 212 PGGYIDLLVYsgP--GIIADRGVLALLLGTIIISASQVSHAWVPLSFLGIFGLLIRLF-------GGLPfgdlrgngdIL 282 Treponema pr...
AEB14251        195 PDGYVSLFWDngSvipa--frfNFITLVSSIILVSFDMIDYVVPAVFLFVYSFLVRFL-------LPFFiggipfqgdIL 265 Treponema su...
Q73MW5          191 PEGYISLFLNstSsipa--fryNIVTLVSSIILFSIRAVDYILPAFFLATYAVLVWIF-------GMAPvsniyftgdIL 261 Treponema de...
4P6V_B          329 WHLVLGGFAFGMFFMATDPVSASFTNSGKWAYGILIGVMCVLIRVVNpAYPEGMMLAILFANLFAPLFDHVVVERNIK 406
CCX67174        231 IQLGGGSFLFTAFVMAEDYTTSPISFAARCWYGLIFGAAVFWVRKAG-FYEDAVVYALLLVNLLRPLLDKKLAPKPFG 307 Firmicutes bac...
CDD02047        247 TQLFSGGIFLVSVFMLSDYATSPSTMAGKIAFGVVCAVFTVAIRYYG-MIHYGEYFALLVSNMLVPVIDKATWQRVYG 323 Ruminococcus s...
CCY91197        253 MEICGGMLLFSSVFFLTDDKLLPKSFYSRICYGAAAGLMCMIMRSVG-KFEDSTVFAVLLANGLVTAFDKLpltkrer 329 Eubacterium sp...
WP_022132922    240 NEMFAGSLFFVSVYLLNDPVTTPKYRIARILYGFSAGLMTMFFRYNS-PFELSAVFAILLMNALSPAFDCFCewlmpk 316 Negativibacill...
CDA62709        240 NEVFAGSLFFVAVYIINDPVTTPKYRIARVIYGLCAGLLTMVFRYYS-PLEFSAVFAVLLMNALAPAFDTLceflipw 316 Clostridium sp...
WP_015711641    282 FALSTGGVLPVAFILAADPATAAKSNWGILGASIAGACLAFFFRFYG-GEAYGAIFAVLVVNALLPIVRAFEARhfyd 358 Treponema azot...
jcvi:TREPR_1747 283 FGFFTGGTLVAAFLLAADPSTGPKSHIGVLAASVLAGFFSFVFRYRG-VEPYGAFFATLLINALIPLLRYFETRRLYl 359 Treponema prim...
AEB14251        266 LALLTSGTLFCTLYLLQWFGTLPMTLWGKFLYGAFAGLIGFLIIGSG-TSSAGYVFLILVINLISPVIQFFEDKKLye 342 Treponema succ...
Q73MW5          262 SAVLTGGILFAAFFVMTEPASSPKTKYGKAMIGFFTGVFAFFICAHG-ASPAGIFFAIILGNIISPLIERLEIKIQAK 338 Treponema dent...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap