Conserved Protein Domain Family
DBD_Tnp_Mut

?
pfam03108: DBD_Tnp_Mut 
MuDR family transposase
This region is found in plant proteins that are presumed to be the transposases for Mutator transposable elements. These transposons contain two ORFs. The molecular function of this region is unknown.
Statistics
?
PSSM-Id: 397295
Aligned: 7 rows
Threshold Bit Score: 97.084
Threshold Setting Gi: 77551154
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE01929      178 EVIQGAIYSRAEDMKEAVKHFAVSLHREFRVAKSN-RSQYEVRCVkeKDGCPWRVHAYKGKWKDYWTV 244  Japanese rice
Q9C702        179 TMRVGLCFKDLAEMKKAVDWCSIKRRQKCLLRETE-KDVYVVECE--RWHCKWSICASRREEDGLFEI 243  thale cress
Q2QMP0        173 QLVVGQEFPDVMSCRRAIRNTAIACHFEIQTVKSD-KTRFTAKCS--ADGCPWRIHAAKLPGVPTFSI 237  Japanese rice
Q0DAT1        146 ITGVGQVFDGPKDFRDALHKYAIAHKFHYRFIKND-SSRVTAECT--GEDCPWRIHASKSPAKKQFMI 210  Japanese rice
XP_013647911  193 itGLGQRFKNVGEFRESLRKYAIANQFGFRYKKND-SHRVTVRCK--AEGCPWRIHASRLSTTQLICI 257  rape
Q0D1G9          8 KWRRGLKFPSLEEGRAALIQHTIDQQQSFRVDKSD-HKRFFTRCLs-GRGCPYRVRLYVRRDTVQAQV 73   Aspergillus terreus NIH2624
ABA93951      295 gLRKGLEFPSMVALKLWLQEYAIVHHRPYRVVNSAaNRRYTVKCE--NPRCKWKVHATKRSS-GTWRI 359  Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap