2WQP


Conserved Protein Domain Family
NeuB

?
pfam03102: NeuB 
Click on image for an interactive view with Cn3D
NeuB family
NeuB is the prokaryotic N-acetylneuraminic acid (Neu5Ac) synthase. It catalyzes the direct formation of Neu5Ac (the most common sialic acid) by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). This reaction has only been observed in prokaryotes; eukaryotes synthesize the 9-phosphate form, Neu5Ac-9-P, and utilize ManNAc-6-P instead of ManNAc. Such eukaryotic enzymes are not present in this family. This family also contains SpsE spore coat polysaccharide biosynthesis proteins.
Statistics
?
PSSM-Id: 397290
Aligned: 80 rows
Threshold Bit Score: 258.2
Threshold Setting Gi: 123551153
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WQP_A            41 VDAAYN-AGAEVVKHQTHIVEDEXSDEAKQVIp-----GNADvSIYEIXERCALNEEDEIKLKEYVESKGXIFISTLFSR 114 Neisseria m...
Q82UC3           152 VNLAVE-AGADCVKFQMRDLSSLYSNQGRNAEag--ydLGSQ-YTLDLLNKFQLNHDELCQVFDYCRQQDILPLCTPWDL 227 Nitrosomona...
WP_009543464     152 IDDAIT-AGANCAKFQLRSLKSLYHNAGNADDas--edLGSQ-YTLDLLSRFQLSDEEMLQAFDYCKEKEILPLCTPWDL 227 Crocosphaer...
Q82HY4            41 IDAAAE-AGCDAVKFQKRTPEICTPRDQWDIErd--tpWGRM-TYIDYRHRVEFGEDEYRQIDEYAKSKNIDWFASPWDT 116 Streptomyce...
Q47U14            51 IEVAAE-AGCHAVKFQKRTPEICVPKEQRDKIrq--tpWGEM-TYLEYKHRVEFGRDEYTEIAKICEENGLQWFASPWDV 126 Thermobifid...
jgi:Acid345_2841  47 ISVAVG-AGCDAVKFQKRTIDVVYTAAELAKPre--npFGA--TNGDLKRGLEFGLEEFKEIDRYCREVRMPWFASAWDE 121 Candidatus ...
jgi:Caul_2713     54 IRAARD-AGCDAVKFQKRTIDIVYTPEVLAQPrq--spWGD--TQRAQKEGLEFGKAEYDVIDAYCRELGLAWFASAWDV 128 Caulobacter...
CAG11542          40 IKMAKD-CGADCAKFQKSELEDKFNRRALERPytskhsWGK--TYGEHKRHLEFSHDQYEELQKYAEEVGIFFTASGMDE 116 spotted gre...
Q2YC05            25 IGIAATfAKCDFVKFQKRSNRELLTPEeynah-hpnpqNSYGdSYGAHREFLEFDVDQHRQLQQWCQEFGIGYSTSVWDL 103 Nitrosospir...
Q8TJL5            25 IKVAAQfCKVDIVKFQKRTPVELLTPEeynap-hpvphNSYGkTYGEHREFLEFNLDQHKQLKKWCDDWGVVYSTSVWDL 103 Methanosarc...
2WQP_A           115 AAALRLQRXDIPAYKIGSGECNNYPLIKLVAS-FGKPIILSTGXNSIESIKKSVEII--REAGVPYALLHCTNIYPTPYE 191 Neisseria m...
Q82UC3           228 VSAHVLDEYGLEAFKVASADFTNYEMLETLAK-TGKPLLCSTGMSSEAEIKGSVDLL--RRLGAPFALLHCNSTYPAPFK 304 Nitrosomona...
WP_009543464     228 DSLKILENYGMVAYKVASADFTNHELLKALAK-TGKPLICSTGMSTEAEISQSVQLL--QKLGAMYVLLHCNSTYPAPFK 304 Crocosphaer...
Q82HY4           117 EAVAFLEKFDIPAHKVASASLTDDELLRALRG-TGRTVILSTGMSTPKQIRHAVEVL----GSDNILLCHATSTYPAKAE 191 Streptomyce...
Q47U14           127 PSVEFLESFDVVAHKVASASITDHELLRALAA-TGKPIILSTGMSTIEEIDAAVEIF----DRSKLILMHSTSTYPMPPE 201 Thermobifid...
jgi:Acid345_2841 122 ASVDFIAQFDVPCFKIASASLTDDNLLRHTRA-TGKPVMLSTGMSTVEQIDHAVDVL----GKDNLILLQACSTYPAYYE 196 Candidatus ...
jgi:Caul_2713    129 PSQTFLAAYDLPYNKIASAMLTHRPLIEAVAA-EGKLVFASTGMCTFEQIDTAVEIL--RAAACPFVLMHTVSTYPTPPA 205 Caulobacter...
CAG11542         117 MAVEFLHELKVPFFKVGSGDTNNFPYLEKTAK-KGRPMVVSSGMQSMATMRRVYKTV--KEHNQNFAILQCTSAYPLEAE 193 spotted gre...
Q2YC05           104 TSAKEIARLNPEFIKIPSACNLNFPMLAYLATdYAGDIHISVGMTTPAEQEQVVQWMerHGAAGRVVLYACTSGYPVPFD 183 Nitrosospir...
Q8TJL5           104 TAAKEIVSINPELIKIPSACNLKFDMLEYLCKeYDGEIHLSFGMTTNEEEEKVVTFFedRGRGKDLIIYSCTSGYPVPFE 183 Methanosarc...
2WQP_A           192 DVRLGGXNDLSEAFPd-AII-GLSDHTLDNYACLGAVALGGSILERHFTDRXDRPGPDIVCSXNPDTFKELKQGAHALKL 269 Neisseria m...
Q82UC3           305 DVNLNYLPHLKQLGG--TVV-GYSGHERGFSVPLAAVALGARIVEKHFTVDRSMEGNDHKVSLLPEEFAEMVRQIRNIEE 381 Nitrosomona...
WP_009543464     305 DVNLNYITRLKELGD--CPV-GYSGHERGISVAIAAVAKGAKVIEKHFTLDKSMEGNDHKVSLLPQEFKAMVEGIRQVEE 381 Crocosphaer...
Q82HY4           192 ELNLRVINTLQAEYPn-VPI-GYSGHETGLQTTLAAVALGATFVERHITLDRAMWGSDQAASVEPQGLTRLVRDIRTIEA 269 Streptomyce...
Q47U14           202 EANLRTIITLRERYG--VPV-GYSGHERGLQISLAAVTLGAVAVERHITLDRTMWGSDHAASLEPAGLQHLVRDIRVIEQ 278 Thermobifid...
jgi:Acid345_2841 197 ELNLKAIHTLMDRYG--VPV-GYSGHETGLPASIAAAAMGACVLERHITLDRAMWGSDQAASLEPNGITQLVRYLRIVEK 273 Candidatus ...
jgi:Caul_2713    206 DLNLLTIDTLRRRYG--APV-GYSGHESSVEPSLVAAMLGAVAIERHITLDRTMYGSDQSASLEPDELKVLVSRLRDLRE 282 Caulobacter...
CAG11542         194 DVNLRVITEYQKEFPd-IPI-GYSGHESGVSITVAAVALGAKIIERHVTLDKTWKGSDHAASLEPSELAELVRSIRLVER 271 spotted gre...
Q2YC05           184 QVCLLEIQSLRDRFGsrVKEvGFSGHHLGIAIDIATVVLGASWIERHFTLDRTWKGTDHAASLEPDGLRRLVRDVRNVCK 263 Nitrosospir...
Q8TJL5           184 DICLKEILRIRAKFEkrVKGiGFSGHHLGIAADIAALAYGAKYFERHFTLDRTWKGTDHAASLEPDGMRRLARDLRNVSK 263 Methanosarc...
2WQP_A           270 ARGGKKD 276 Neisseria meningitidis serogroup B
Q82UC3           382 ALGQGGE 388 Nitrosomonas europaea
WP_009543464     382 ALGTSse 388 Crocosphaera subtropica
Q82HY4           270 SLGDGVK 276 Streptomyces avermitilis
Q47U14           279 ALGDGVK 285 Thermobifida fusca YX
jgi:Acid345_2841 274 SMGDGVK 280 Candidatus Koribacter versatilis Ellin345
jgi:Caul_2713    283 WLGDGEK 289 Caulobacter sp. K31
CAG11542         272 ALGNGVK 278 spotted green pufferfish
Q2YC05           264 TLKFKEG 270 Nitrosospira multiformis ATCC 25196
Q8TJL5           264 ALTYKQK 270 Methanosarcina acetivorans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap