Conserved Protein Domain Family
Mlo

?
pfam03094: Mlo 
Mlo family
A family of plant integral membrane proteins, first discovered in barley. Mutants lacking wild-type Mlo proteins show broad spectrum resistance to the powdery mildew fungus, and dysregulated cell death control, with spontaneous cell death in response to developmental or abiotic stimuli. Thus wild-type Mlo proteins are thought to be inhibitors of cell death whose deficiency lowers the threshold required to trigger the cascade of events that result in plant cell death. Mlo proteins are localized in the plasma membrane and possess seven transmembrane regions; thus the Mlo family is the only major higher plant family to possess 7 transmembrane domains. It has been suggested that Mlo proteins function as G-protein coupled receptors in plants; however the molecular and biological functions of Mlo proteins remain to be fully determined.
Statistics
?
PSSM-Id: 397283
Aligned: 35 rows
Threshold Bit Score: 606.189
Threshold Setting Gi: 356540817
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_006850616   7 SRSLEETPTWAVAVVCFVMVLVSILIEHAIHLVGKWLTKRHKRALYEALEKIKAELMLLGFISLLLTIGQDTISRICISK 86  Amborella trich...
O22752        30 GKELSQTPTWAVAVVCTFLILISHLLEKGLQRLANWLWKKHKNSLLEALEKIKAELMILGFISLLLTFGEPYILKICVPR 109 thale cress
O22757        38 HKQLNQTPTWAVAAVCTFFIVVSVLLEKLLHKVGKVLWDRHKTALLDALEKIKAELMVLGFISLLLTFGQTYILDICIPS 117 thale cress
XP_009382074  11 SRELDQTPTWAVAVVCAVIVVISILLEKGLHRFGEWLTEKHKKALFEALEKIKAELMILGFISLLLTFGQKYIVKICVPY 90  wild Malaysian ...
XP_002892614   8 GRSLAETPTYSVASVVTVLVFVCFLVERAIYRFGKWLKKTRRKALFTSLEKMKEELMLLGLISLLLSQSARWISEICVNS 87  Arabidopsis lyr...
EEF29044       9 GTTLEYTPTWVVALVCSVIVVISLAVERLLHYLGKLLKRKQQKPLFEALQKIKEELMLLGFISLLLTVFQGRINSICIPE 88  castor bean
CDY30455       5 GTSLEYTPTWVVALVCSVIVSISFAVERGLHRAGKHFDKNNQKQLSGALQKVKEELMLLGFISLLLSVSQSRIAKICISK 84  rape
O80580         5 GTTLEYTPTWVVALVCSVIVSISFAVERLIHRAGKHFKNNDQKQLFGALQKIKEELMLVGFISLLLSVGQSKIAKICISK 84  thale cress
XP_009391802   7 HESLEYTPTWVVAAVCTIIVVISLLVERFLHYLGKFLKHNQQDALYKALQKLKEELMLLGFISLLLTVFQRTISRICVSK 86  wild Malaysian ...
EMS53724      10 SRELDQTPTWAVASVCGVIVLISILLEMGLHKVGEWFAHRKKKAMVEALEKVKAELMVLGFISLLLVFGQSYIIKICISE 89  Triticum urartu
XP_006850616  87 SM-GDSLLPCRKNDQSingG---------------------EHVSESGDDdeg-----ssNR------------------ 121 Amborella trich...
O22752       110 KA-ALSMLPCLSEDTVlfqK---------------------LAPSS---------------------------------- 133 thale cress
O22757       118 HV-ARTMLPCPAPNL----K---------------------KEDDDNGES----------HR------------------ 143 thale cress
XP_009382074  91 KV-ADTMLPCSRKTDT---E---------------------TEEEADGRH----------RR------------------ 117 wild Malaysian ...
XP_002892614  88 SLfNSKFYICSEEDYGihkK------------------------------------------------------------ 107 Arabidopsis lyr...
EEF29044      89 EM-SKKWLPCKEESETattT---------------------T-------------------------------------- 108 castor bean
CDY30455      85 EL-SEKLLPCKKPKEDk-sL---------------------NDN------------------------------------ 105 rape
O80580        85 EL-SEKFLPCTKPAGAeksL---------------------KDS------------------------------------ 106 thale cress
XP_009391802  87 RL-FHHMLPCKENSFPpnqEvhrakglklqltwnnrkllseDE------------------------------------- 128 wild Malaysian ...
EMS53724      90 AA-ADTMLPCRLKKATvevE---------------------IAKDGGHGApaggakeehgAKqpeehfslgtnpftatsf 147 Triticum urartu
XP_006850616 122 ----RLLWLDDFDQphpSLRRVLAGS---KYDKCSPQGKVPLISYDGTHQLHIFIFVLAVFHVLYCISTMALGRLKMKRW 194 Amborella trich...
O22752       134 -----------------LSRHLLAAGd--TSINC-KQGSEPLITLKGLHQLHILLFFLAIFHIVYSLITMMLSRLKIRGW 193 thale cress
O22757       144 ----RLLSF---------EHRFLSGGe-aSPTKCTKEGYVELISAEALHQLHILIFFLAIFHVLYSFLTMMLGRLKIRGW 209 thale cress
XP_009382074 118 ----RLLTNALTDPn--GKHRILAAG---SIVSC-SAGKVPLISTNGLHQLHILIFFLAVFHVASSFTTMALGRLKMRRW 187 wild Malaysian ...
XP_002892614 108 ----VLLEHTSSTNqssLPHHGMHE----ASHQCG-HGREPFVSYEGLEQLLRFLFVLGITHVLYSGIAIGLAMSKIYSW 178 Arabidopsis lyr...
EEF29044     109 ----AHFQTFFSFIsggAPQRHLLAEssdSSSSCP-EGKVPILSTTALHHLHIFIFVLACVHVAFCALTILFGSAKIRQW 183 castor bean
CDY30455     106 ----SHFQLSFT-------GRHLLAGdsgAGDYCSQKGKAPLMSISALHELHIFIFVLAIAHIIFCLLTILFGTMKIMQW 174 rape
O80580       107 ----SHFQFSFT-------GRHLLAGdapAGDYCSLKGKVPIMSLSALHELHIFIFVLAVAHIIFCLLTIVFGTMKIKQW 175 thale cress
XP_009391802 129 -----------------------------GSDICMRQGKVPLLSLEALHQLHIFIFVLAVVHVVFCATTMVLGGAKIRKW 179 wild Malaysian ...
EMS53724     148 svphRMLSEATSFS---VPHRMLSEAn--MNTKCP-PGKVSLISINALHQLHIFIFFLAVFHVCYSATTMALGRAKIRGW 221 Triticum urartu
XP_006850616 195 KKWEQETKTIEYQWSH--DPERFRFARET-SFGRRHL-NFWTKSPILIWIVCFFRQFVRSVPKVDYLTLRHGFIMAHLAP 270 Amborella trich...
O22752       194 KKWEQETLSNDYEFSI--DHSRLRLTHET-SFVREHT-SFWTTTPFFFYVGCFFRQFFVSVERTDYLTLRHGFISAHLAP 269 thale cress
O22757       210 KHWENETSSHNYEFST--DTSRFRLTHET-SFVRAHT-SFWTRIPFFFYVGCFFRQFFRSVGRTDYLTLRNGFIAVHLAP 285 thale cress
XP_009382074 188 KHWESEISSPEYEFSK--DPSRFRFTHET-SFVRRHT-SIWNRVTICFYFVSFFRQFFRSVCKADYLALRHGFINVHLAP 263 wild Malaysian ...
XP_002892614 179 RKWEAQAIIMAESDIH--AKKTKVMKRQS-TFVFHHAsHPWSNNRFLIWMLCFLRQFRGSIRKSDYFALRLGFLTKHNLP 255 Arabidopsis lyr...
EEF29044     184 KHWEDSVTKGEYDQEE----ARLTHVQDH-DFIKKRFkGIGKNSYLLGWVHSFFKQFYGSVTKSDYITLRLGFIMTHCRG 258 castor bean
CDY30455     175 RKWEDKVLEKDYNADEv-IQKKYTAVREH-DFIRGRFlGVGKADACFGWVHSFMKQFLASVNESDYITMRLGFVTTHCKT 252 rape
O80580       176 KKWEDKVLEKDFDTDQ--SIKKFTHVQEH-EFIRSRFlGVGKADASLGWVQSFMKQFLASVNESDYITMRLGFVTTHCKT 252 thale cress
XP_009391802 180 KLWENDIRKGQPKKETlsAEELSTHVQQHnEFVMEHTeGLQQRSVVLSWIMSFLKQFYASVTKSDYIALRSGFIMKHCSS 259 wild Malaysian ...
EMS53724     222 KEGEKEAAGQDEEVTN--DPSQFRFTHET-SFVRQHM-NVLNKTPASFYISNFFRQFFRSVRRADYCALRHSFVNVHLAP 297 Triticum urartu
XP_006850616 271 QSStkFDFHKYIKRSLEEDFKVVVGISPIIWFFAVVFLLFNTHGWYSYLWLPFIPLIIILLVGTKLQVVITKMGLKIQDR 350 Amborella trich...
O22752       270 GRK--FNFQRYIKRSLEDDFKLVVGISPVLWASFVIFLLFNVNGWRTLFWASIPPLLIILAVGTKLQAIMATMALEIVET 347 thale cress
O22757       286 GSQ--FNFQKYIKRSLEDDFKVVVGVSPVLWGSFVLFLLLNIDGFKMMFIGTAIPVIIILAVGTKLQAIMTRMALGITDR 363 thale cress
XP_009382074 264 GSK--FNFQKYIKRTLEDDFKMVAGISPVLWASAVIILLLNVHGWKEKFWASIIPLVTILAVGMKLHVIITRMAIEIEER 341 wild Malaysian ...
XP_002892614 256 FT---YNFHMYMVRTMEDEFHGIVGISWPLWVYAIVCICINVHGLNMYFWISFIPAILVMLVGTKLEHVVSKLALEVKEQ 332 Arabidopsis lyr...
EEF29044     259 NPK--FNFHKYMMRALEADFKKVVGISWYLWLFVVIFLLLNVAGWHAYFWIAFIPFVLLVAVGAKLEHVITQLAHEVAEK 336 castor bean
CDY30455     253 NPK--FNFHKYLIRALNSDFKKVVGISWYLWVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEK 330 rape
O80580       253 NPK--FNFHKYLMRALNSDFKKVVGISWYLWVFVVLFLLLNIVAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEK 330 thale cress
XP_009391802 260 NPD--FDFHKYMLRTLEDDFKIVVGIRWYLWLFVVLFLLLNVNGWHTFFWLSFLPLVLLLAVGTKLEHIITCLAQEAAEK 337 wild Malaysian ...
EMS53724     298 GSK--FDFQKYIKRSLEDDFKVIVGISPILWASALTFLLININGLHSMLWISIMPLVIILLVGTKLQGIICRMAIDITER 375 Triticum urartu
XP_006850616 351 GDVVKGVPVVQPTDKLFWFNQPRLILYLIHFVLFQNAFQLAFFTWTWYEFGLRSCFHKHLEDVIIRISMGVLIQFLCSYV 430 Amborella trich...
O22752       348 HAVVQGMPLVQGSDRYFWFDCPQLLLHLIHFALFQNAFQITHFFWIWYSFGLKSCFHKDFNLVVSKLFLCLGALILCSYI 427 thale cress
O22757       364 HAVVQGMPLVQGNDEYFWFGRPHLILHLMHFALFQNAFQITYFFWIWYSFGSDSCYHPNFKIALVKVAIALGVLCLCSYI 443 thale cress
XP_009382074 342 HTVIQGIPLVQLSDHHFWFGRPYFVLFLIHFALFQSAFQITYFFWIWYEFGLKSCFHENFVSIIVKVIIGVLVQFFCSYI 421 wild Malaysian ...
XP_002892614 333 QTGTSNGAQVKPRDGLFWFGKPEILLRLIQFIIFQNAFEMATFIWFLWGIKERSCFMKNHVMISSRLISGVLVQFWCSYG 412 Arabidopsis lyr...
EEF29044     337 HIAVEGDLVVQPSDDHFWFHRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCIMEEVGYLIPRLIIGVFIQFVCSYS 416 castor bean
CDY30455     331 HIAVEGDLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKFIIPRLVIGVLVQLLCSYS 410 rape
O80580       331 HIAVEGDLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFEIAYFFFILFQFGWDSCIMDHVKFVIPRLVIGVIIQLLCSYS 410 thale cress
XP_009391802 338 PTDGQ-VPKVKPSDHHFWFNQPGILLYLIHFILFQNAFELAYFFWIISTYGFYSCIMEKVGYIIPRLLVGVIIQVLCSYS 416 wild Malaysian ...
EMS53724     376 HAVIQGIPLVQVSDSYFWFSRPTFVLFLIHFTLFQNGFQIIYFLWILYEYGMDSCFNDSKKLVFARLCLGAVVQVLCSYV 455 Triticum urartu
XP_006850616 431 TLPLYALVTQMGSNMKTTVFDDRVAAALRKWHHTAKKHIK-EGRKS-ASV--------TP--FSSRPGTPLhpsaggEGL 498 Amborella trich...
O22752       428 TLPLYALVTQMGSHMKKAVFDEQMAKALKKWHKDIKLKKG-KARKL-PSKtlgvsesfSL-----------------SSS 488 thale cress
O22757       444 TLPLYALVTQMGSRMKKSVFDEQTSKALKKWRMAVKKK---KGVKA-TTKrlggdgsaSP------TASTV------RST 507 thale cress
XP_009382074 422 TLPLYALVSQMGSHMKRSIFDEETSKALIKWHQIAKKKQE-KGLSR-SSSvhepsstmSP------------------QA 481 wild Malaysian ...
XP_002892614 413 TVPLNVIVTQMGSRHKKAVIAESVRDSLHSWCKRVKERSK-HTRSV-CSLdtatiderDEmtVGTLSRSSSmtslnqITI 490 Arabidopsis lyr...
EEF29044     417 TLPLYAIVTQMGSSFKKAIFDEHIQTGLVGWAKQVKKKMVlRKAAN-GS---------TQ--VSKKED----------SP 474 castor bean
CDY30455     411 TLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAK-----MAKKK-GS---------TH--AGSSHGG-SpnpiatPSP 472 rape
O80580       411 TLPLYALVTQMGSSFKGAIFNEQTQEHLVGWAKMAK-----RGVKK-GA---------TQ--VGTSHDATSpr------- 466 thale cress
XP_009391802 417 TLPLYTIVTQMGDMFKQAIFDELLRSTLHGWAETIRKRKEpKTFGV-SS---------FMkvINSKSKTSV-------SG 479 wild Malaysian ...
EMS53724     456 TLPLYALVSQMGTTMKQSIFDDQTSKALKSWRAGVKKKPAaNSKHGsGSPs------gSP--RAGSPKAGD------EGS 521 Triticum urartu
XP_006850616 499 S-PVHLLRHYK 508 Amborella trichopoda
O22752       489 S-SATTLHRSK 498 thale cress
O22757       508 S-SVRSLQRYK 517 thale cress
XP_009382074 482 S-PVNPMQrsa 491 wild Malaysian banana
XP_002892614 491 N-SIDqaesif 500 Arabidopsis lyrata subsp. lyrata
EEF29044     475 G-SVQLSHAGS 484 castor bean
CDY30455     473 K-SIQLQSLLV 482 rape
O80580       467 -pSIQLNSLLG 476 thale cress
XP_009391802 480 S-RIQMQntil 489 wild Malaysian banana
EMS53724     522 TaGIALTQKqg 532 Triticum urartu
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap