Conserved Protein Domain Family
GNT-I

?
pfam03071: GNT-I 
GNT-I family
Alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase (GNT-I, GLCNAC-T I) EC:2.4.1.101 transfers N-acetyl-D-glucosamine from UDP to high-mannose glycoprotein N-oligosaccharide. This is an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides. The enzyme is an integral membrane protein localized to the Golgi apparatus, and is probably distributed in all tissues. The catalytic domain is located at the C-terminus.
Statistics
?
PSSM-Id: 397273
Aligned: 3 rows
Threshold Bit Score: 732.478
Threshold Setting Gi: 19863012
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P26572  12 WGAILFVAWNALLLLFFWTRPAPGrPPSVSALDGDPASltrEVIRLA--QDAEVELERqrGLLQQIGDALSSQRGRVPT- 88  human
Q11068   1 MHAVTKIFIIFIFVFILWTLYVEN-DITNRTRNTDNID---DLLESAnrLERLLKFEA--KKIAALAEDVHKIRANRKGk 74  Caenorhabditis elegans
Q9XGM8  13 IPAAFMFIYIQMRLFQTQSQYADRlSSAIESENHCTSQmrgLIDEVSikQSRIVALED---MKNRQDEELVQLKDLIQT- 88  thale cress
P26572  89 -AAPPAQPRVPVTPAPAVIPILVIACDRST-VRRCLDKLLHYR-PSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQP 165 human
Q11068  75 hVIMEEMVSQDLKQWKDPIPVLVFSCNRAMaVRDHVEKLIRYR-PSQEKFPIIVTQDCDNENVKNEVKKFGDKVEYIKHL 153 Caenorhabditis elegans
Q9XGM8  89 -FEKKGIAKLTQGGQMPVAAVVVMACSRADyLERTVKSVLTYQtPVASKYPLFISQDGSDQAVKSKSLSY-NQLTYMQHL 166 thale cress
P26572 166 --DLSSIAVP-PDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWN 242 human
Q11068 154 agDKANITIP-PSHRQYTAYYRIARHYKLALNHVFVDKGYSSVIITEDDLDISPDFFSYFSSTRYLLENDEKLWCVTAWN 232 Caenorhabditis elegans
Q9XGM8 167 --DFEPVVTErPGE--LTAYYKIARHYKWALDQLFYKHKFSRVIILEDDMEIAPDFFDYFEAAASLMDRDKTIMAASSWN 242 thale cress
P26572 243 DNGKEQMVDASRPELLYRTDFFPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRQGRACIRPEISRT--MTFGRKGVS 320 human
Q11068 233 DNGKQENIDMTAASTLYRSDFFAGLGWMMSSKTWHELEPIWPVGFWDDWMRDPARRKDRQCIRPEISRTgmMSYGKEGAS 312 Caenorhabditis elegans
Q9XGM8 243 DNGQKQFVHD--PYALYRSDFFPGLGWMLKRSTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRT--YNFGEHGSS 318 thale cress
P26572 321 HGQFFDQHLKFIKLNQQFVHFTQLDLSYLQREAYDRDFLARV-YGAPQLQVEKVRTNDRK--ELG-EVRVQYTGRDSFKA 396 human
Q11068 313 KGQFFSKHLAKIKVNDKYINFGKIDLDYLLPANFAKKTNLEVmKEAVELSIDNVASFVLSseNKGkSVRVMYDGNIDYIR 392 Caenorhabditis elegans
Q9XGM8 319 LGQFFSQYLEPIKLNDVTVDWKAKDLGYLTEGNYTKYFSGLV-RQARPIQGSDLVLKAQN--IKD-DVRIRYKDQVEFER 394 thale cress
P26572 397 FAKALGVMDDLKSGVPRAGYRGIVTFQFRG-RRVHLAPPLT-WEGYDPSW 444 human
Q11068 393 KADKLHIMHDFKAGVPRTAYDGIVTCFING-IRIYLVPDRTkVSAYNPDW 441 Caenorhabditis elegans
Q9XGM8 395 IAGEFGIFEEWKDGVPRTAYKGVVVFRIQTtRRVFLVGPDS-VMQLGIRN 443 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap