1NLM,5GL5


Conserved Protein Domain Family
Glyco_transf_28

?
pfam03033: Glyco_transf_28 
Click on image for an interactive view with Cn3D
Glycosyltransferase family 28 N-terminal domain
The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
Statistics
?
PSSM-Id: 397255
Aligned: 26 rows
Threshold Bit Score: 86.5676
Threshold Setting Gi: 505814151
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NLM_B    9 LMVMAGGTGGHVFPGLAVAHHLMAQGWQVRw--LGTADRMEADLv-PKHGIEIDFIRIS---------GLRGk-gIKALI 75   Escherichia coli
Q9M8Z7  195 IVMLIVGTRGDVQPFVAIAKRLQDYGHRVR---LATHANFKEFV--LTAGLEFYPLGGDpkvlagymvKNKGf--LPSGP 267  thale cress
O83535   15 VVFTGGGTGGHIFPGIAVFQALAQQA-AVRvvwIGAARGADRSIv-ESAGLEFCGITAG---------KWRRy-aSVRNF 82   Treponema pallidum ...
O51708    7 IFFTGGGTGGHVFPGISIIQKLKEFDNEIEffwIGKKNSIEEKLikEQDNIKFISIPCG---------KLRRy-fSFKNF 76   Borreliella burgdor...
Q9HYD1    3 aILIAIGSAGDVFPFIGLARTLKLRGHRVS---LCTIPVFRDAV--EQHGIAFVPLSDEl--------TYRRt-mGDPRL 68   Pseudomonas aeruginosa
Q9XIG1  158 IAILVVGTRGDVQPFLAMAKRLQEFGHRVR---LATHANFRSFV--RAAGVEFYPLGGDprelaaymaRNKGl--IPSGP 230  thale cress
Q54IL5 1166 ITILTIGSRGDIQPFIALSLGLKEYGHNVT---LATHELYRDLIs-KEFGLNYQPLGGDprel--mdlCVRNgifTPKFI 1239 Dictyostelium disco...
Q5A950 1017 ITLLTIGSRGDVQPYIALGKGLVKEGHNVT---IATHAEFGDWI--KTFGLGFKEIAGDpaelmsfmvTHNSm--SVGFL 1089 Candida albicans SC...
5GL5_B   42 FGLLTIGSRGDVQPYIALGKGLIKEGHQVV---IITHSEFRDFV--ESHGIQFEEIAGNpvelmslmvENESm--NVKML 114  Saccharomyces cerev...
Q9Y751  763 FVLLTIGSRGDVQPYISLAKGLLAENHKVK---IVTHEEFKPWV--ESYGIEFATIAGNpaelmslmvTHKSl--SVGFL 835  Komagataella phaffi...
1NLM_B   76 AAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLAAWSLGIPVVLHEQNGIAGLTNKWLAKIATKVMQ 147  Escherichia coli
Q9M8Z7  268 SEIPIQRNQMKDIIYSLLPACKEPDPDSGISFKADAIIANPPAYGHTHVAEALKIPIHVFFTMPWTPTSEFP 339  thale cress
O83535   83 FDVFRVLVGTVQSYCILRALRPQALFSKGGFVSVPPCIAAWLLRIPVVTHESDISPGLATRINARFADRILV 154  Treponema pallidum subsp. p...
O51708   77 TDFFKVILGIIKSFYVLKKYKPQLIYATGGFVSTPAIIASSLLKIKSITHEMDLDPGLATKINSKFANNIHI 148  Borreliella burgdorferi B31
Q9HYD1   69 WDPKTS--FGVLWQAIAGMIEPVYEYVSAQRHDDIVVVGSLWALGARIAHEKYGIPYLSAQVSPSTLLSAhl 138  Pseudomonas aeruginosa
Q9XIG1  231 SEISKQRKQLKAIIESLLPACIEPDLETATSFRAQAIIANPPAYGHVHVAEALGVPIHIFFTMPWTPTNEFP 302  thale cress
Q54IL5 1240 KEALSR-------FRSFIDDLLLTCWKAVQNSNTQVLIATPGCFAGPHIGEVLQIPFFNAFTMPFTRTRTYP 1304 Dictyostelium discoideum
Q5A950 1090 KNAQQK-------FRSWISKLLTTSWEAC--QGSDILIESPSAMSGIHIAEALGIPYFRAFTMPWTRTRAYP 1152 Candida albicans SC5314
5GL5_B  115 REASSK-------FRGWIDALLQTSWEVCNRRKFDILIESPSAMVGIHITEALQIPYFRAFTMPWTRTRAYP 179  Saccharomyces cerevisiae S288C
Q9Y751  836 KEAKEK-------FTGWIGELLQSSWDAC--QDADVLIESPSAMAGIHIAEKLQIPYFRAFTMPWTRTRAYP 898  Komagataella phaffii GS115
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap