Conserved Protein Domain Family
Papilloma_E5

?
pfam03025: Papilloma_E5 
Papillomavirus E5
The E5 protein from papillomaviruses is about 80 amino acids long. The proteins are contain three regions that are predicted to be transmembrane alpha helices. The function of this protein is unknown.
Statistics
?
PSSM-Id: 145918
View PSSM: pfam03025
Aligned: 13 rows
Threshold Bit Score: 35.7268
Threshold Setting Gi: 137738
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AEI61819  1 MLAIFVFAFVLLLCFCIVLrPLLLSIYVYALLLVLVLVLW-GFIGSPLRVFLAYLIFLYLPMMCIHLHAQYIVS 73  Human papillomavirus type 67
P26552    2 ILPIFVVCFILFLCLCIFLrPLVLSISIYAWLLVLVLLLW-VSVGSALRIFFCYLIFLYIPMMCINFHAQYLTQ 74  Human papillomavirus type 58
P06426    1 MIFVFVLCFILFLCLSLLLrPLILSISTYAWLLVLVLLLW-VFVGSPLKIFFCYLLFLYLPMMCINFHAQHMTQ 73  Human papillomavirus type 33
P17385   11 IVLCFLLCFCVLLFVCLVIrPLVLSVSVYATLLLLIVILW-VIATSPLRCFCIYVVFIYIPLFVIHTHASFLSQ 83  Human papillomavirus type 31
Q9WGD8   11 LLACFLLCFCVLLCVCLLIrPLLLSVSTYTSLILLVLLLW-ITAASAFRCFIVYILFVYIPLFLIHTHARFLIT 83  Human papillomavirus type 16
P27226   10 VLLCFLLCFCVLLCLCLLVrSLLLSVSLYSALILLVLILW-VTVATPLLAFVVSCFCIYL--WMINAHAQYLAV 80  Human papillomavirus type 35
Q9JH46   23 LVIVFVLCVCVCLLLCRLL-PLLLSIHVFAAHLLIIICFWfVVSTSFTATFFVYICLFYIPAFLLHFYAVILLP 95  Human papillomavirus type 69
Q9IR54    9 LVCLFVLCVCVCLVLCCLL-PLLQSQYVFAAALLLIICFWfVVATSPLTTFTVYLICFYIPCFLLHLYTFSILQ 81  Human papillomavirus type 82
P06792    2 LSLIFLFCFCVCMYVCCHV-PLLPSVCMCAYAWVLVFVYI-VVITSPATAFTVYVFCFLLPMLLLHIHAILSLQ 73  Human papillomavirus type 18
Q81969    2 ITLVFVCCVCVCLCVCCNV-PLLQSVYMCAYTWLLVFVYI-VVITSSYECFLLYILFFIIPLLLLYAHAILSIQ 73  Human papillomavirus type 59
Q9WHG5    2 LIAVFLLCFCVCLYVCCTI-PLFPATNVCAHAWLLVFLLI-VFITTPFTAFIVYIFFFILPMFLLHLHSVHTFD 73  Human papillomavirus - cand85
P24833    2 ILLVFLVWFGVCIYICCNV-PLLPSVHVCAYVWIIVFVFI-LIRTTPLEVFFVYLLFFVLPMWLLHRLA---MD 70  Human papillomavirus type 39
Q2VJD0    2 LVLVFLVWFCVCMYICCTV-PLLQSVHVCVYVWIFVFVFI-LVRTTPFEVFAVYLLFFILPMWLLHSLTLNTIQ 73  Human papillomavirus type 68a
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap