1H9F


Conserved Protein Domain Family
LEM

?
pfam03020: LEM 
Click on image for an interactive view with Cn3D
LEM domain
The LEM domain is 50 residues long and is composed of two parallel alpha helices. This domain is found in inner nuclear membrane proteins. It is called the LEM domain after LAP2, Emerin, and Man1.
Statistics
?
PSSM-Id: 397248
Aligned: 58 rows
Threshold Bit Score: 46.6958
Threshold Setting Gi: 159162383
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1H9F_A          9 DVTELTNEDLLDQLVKYGVNPGPIVGTtRKLYEKKLLKLR 48  
7_pfamImport    1 EVYKLSDNELRSELIRFGFTVGPIAPG-RKLYQRRLTLLR 39  
PDM75253       39 DTMDMSDRQLLNALRALGATVGPVNDGtRAVYQRRLGKLM 78   Pristionchus pacificus
XP_012602347   53 aMAGLSDLELRRELQALGFQPGPITDTtRDVYRNKLRRLR 92   gray mouse lemur
XP_005995528    1 -mASLTAEDLRKELKFLGFSPGPITDStRKLYVNKLNRLR 39   coelacanth
Q9VIE0        406 PLDYETDA-LRRELTQLGAPVGPITKTtKRLYIKQLIKYK 444  fruit fly
Q5TPU6        397 PLDYDTDA-LRAELTTFGEPPGPITSStKKLYLRKLVKLR 435  Anopheles gambiae str. PEST
5_pfamImport    1 DTSGMTDKELRSRLLALGESPGPIGSRtRPVYVRRLRRLL 40  
XP_020557991  730 eiKGMTDKELRLRLVEMGESPGPISSRtRPTYMHRLCRLL 769  Japanese medaka
CAG03487     1539 DTAGMTDKELRRRLVELGESPGPISRHtRPTYMRRLCRLM 1578 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap