2WZL


Conserved Protein Domain Family
PP_M1

?
pfam03012: PP_M1 
Click on image for an interactive view with Cn3D
Phosphoprotein
This family includes the M1 phosphoprotein non-structural RNA polymerase alpha subunit, which is thought to be a component of the active polymerase, and may be involved in template binding.
Statistics
?
PSSM-Id: 397242
Aligned: 5 rows
Threshold Bit Score: 497.838
Threshold Setting Gi: 281306957
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WZL_A   1 MSKDLVHPSLIRAGIVELEMAEETTDLINRTIESNQAHLQGEPLYVDSLPEDMSRLRIEDKSRRTKTEEEERDEGSSEED 80  Mokola lyssavirus
A4UHQ4   1 MSKIFVNPSAIRAGLADLEMAEETVDLVNKNIEDNQAHLQGEPIEVDALPEDMSKLQISERRPAQFTDNTGGKEEGSDED 80  European bat lyssavir...
P06747   1 MSKIFVNPSAIRAGLADLEMAEETVDLINRNIEDNQAHLQGEPIEVDNLPEDMGRLHLDDGKSPNPGEMAKVGEGKYRED 80  Rabies virus strain P...
Q9QSP3   1 MSKIFVNPSAIRAGMADLEMAEETVDLINRNIEDNQAHLQGEPIEVDSLPEEIGKLNINEAKPQSFENNPIDIDGRMNED 80  Australian bat lyssav...
A4UHP9   1 MSKIFVNPSALRSGLADLEMAEETVDLVNKNMEDSQAHLQGIPIDVETLPEDIKRLRIADYKQGQQEEDASRQEEGEDED 80  European bat lyssavir...
2WZL_A  81 NYLSEGQDPLIPFQNFLDEIGARAVKRLKTGEGFFRVWSALSDDIKGYVSTNI-----MTSGERDTKSIQIQTEPTASvS 155 Mokola lyssavirus
A4UHQ4  81 FYMAESEDPYIPLQSYLEGVGIQLVRQMKTGERFFKIWSQAVEEIISYVTVHFpmplgKSTEDKSTQTPEEKFKPSPQ-Q 159 European bat lyssavir...
P06747  81 FQMDEGEDPSLLFQSYLDNVGVQIVRQIRSGERFLKIWSQTVEEIISYVAVNFpnppgKSSEDKSTQTTGRELKKETT-P 159 Rabies virus strain P...
Q9QSP3  81 FQMKEVEDPSIQFQSYLDNIGIQIVRKMKTGERFFKIWSQTVEEIISYVGANFpnpsgKTTESKSTQTTPKKVKPEPP-S 159 Australian bat lyssav...
A4UHP9  81 FYMTESENSYVPLQSYLDAVGMQIVRKMKTGDGFFKIWAQAVEDIVSYVATNFpapvnKLQADKSTRTTLEKVKQAASsS 160 European bat lyssavir...
2WZL_A 156 SGNESRHDSESMHDPNDKKDHTPDHDvvpdiESSTDKGEIRDIEGEVAHQVAESFSKKYKFPSRSSGIFLWNFEQLKMNL 235 Mokola lyssavirus
A4UHQ4 160 AVTKKESQSSKIKTISQESSGPPALE-----WSTTNDEENASVEAEIAHQIAESFSKKYKFPSRSSGIFLFNFEQLKMNL 234 European bat lyssavir...
P06747 160 TPSQRESQSSKARMAAQTASGPPALE-----WSATNEEDDLSVEAEIAHQIAESFSKKYKFPSRSSGILLYNFEQLKMNL 234 Rabies virus strain P...
Q9QSP3 160 APTEKPEQLSRTSMAPETTSGPLALD-----WSATNDDDDVSVEAEIAHQIAESFSKKYKFPSRSSGIFLYNFEQLKMNL 234 Australian bat lyssav...
A4UHP9 161 APSKREGPSSNMNLDSQESSGPPGLD-----WAASNDEDDGSIEAEIAHQIAESFSKKYKFPSRSSGIFLWNFEQLKMNL 235 European bat lyssavir...
2WZL_A 236 DDIVKAAMNVPGVERIAEKGGKLPLRCILGFVALDSSKRFRLLADNDKVARLIQEDINSYMA 297 Mokola lyssavirus
A4UHQ4 235 DDIVKEAKKIPGVVRLAQDGFRLPLRCILGGVGSVNSKKFQLLVNSDKLGKIMQDDLNRYLA 296 European bat lyssavirus 2 strain RV1333
P06747 235 DDIVKEAKNVPGVTRLARDGSKLPLRCVLGWVALANSKKFQLLVESNKLSKIMQDDLNRYTS 296 Rabies virus strain Pasteur vaccin
Q9QSP3 235 DDIVKEARGVPGIIRLAKEGLRLPLRCILGWVASSHSKKFQLLVGSEKLSKIMQDDLNRYMS 296 Australian bat lyssavirus bat/AUS/1996
A4UHP9 236 DDIVREVKGIPGVTRMARDGMKLPLRCMLGSVASNHSKRFQILVNSAKLGKLMQDDLNRYLA 297 European bat lyssavirus 1 strain RV9
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap