Conserved Protein Domain Family
Lentiviral_Tat

?
pfam02998: Lentiviral_Tat 
Lentiviral Tat protein
This family contains retroviral transactivating (Tat) proteins, from a variety of Lentiviruses.
Statistics
?
PSSM-Id: 111843
View PSSM: pfam02998
Aligned: 7 rows
Threshold Bit Score: 134.949
Threshold Setting Gi: 82307146
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9W9Z0  1 MEEAPRRYPGGNRDADgIFQYYEEWECWDWVSQRVPGDILQRWLAMLTNSQLRRKVVKEMQRWIWRNPRAPIIRNCGCRL 80  Brazilian caprine lent...
Q9W8F7  2 TEELPQRREARPEERG-LSLWERERDTWQWTSIRVPGEMLQRWLAMLRLGRNRGKVYREMQKWMWRHPKATVIRPCGCRI 80  Brazilian caprine lent...
P35958  1 MEEVPRRQPGGLVEVEgVFQFYEDWECWDYVSQRVPGERLQRWLAMLTNNQLRRQVIREAQIWMWKHKGAAVRRNCGCRL 80  Visna/maedi virus EV1 ...
Q86553  2 MEEAPRRRPGGTQEIAgIFQFYEDWECWDYVSQRVPDEILQRWLAMLTNQRLRRLVITEAQKWVWRNPKAPVRKNCGCRA 81  Visna/maedi virus EV1
P21124  2 SEELPQRRETHPEELV-RNVRERERDTWQWTSIRVPEEILQRWLAMLRSGRNRKKVYREMQKWMWIHPKGPVIRACGCRL 80  Caprine arthritis ence...
Q9W959  2 NEEAPQRREIHQEDLV-RDIWERERDAWQWISVRAPGEVLQRWLAMLKSGRNRKRVLREMQKLMWRYPKAPVIRPCGCRL 80  Brazilian caprine lent...
Q65930  2 SEELPREREVSPEEAV-RNIWERERDTWQRASIRVPGETLQRWLAMLRLGRHRRKVLREMQKWMWKHPKAPVIRPCGCRL 80  Caprine arthritis ence...
Q9W9Z0 81 CNPGWGS 87  Brazilian caprine lentivirus
Q9W8F7 81 CNPGWGT 87  Brazilian caprine lentivirus
P35958 81 CNPGWGS 87  Visna/maedi virus EV1 KV1772
Q86553 82 CNPGWGS 88  Visna/maedi virus EV1
P21124 81 CNPGWGT 87  Caprine arthritis encephalitis virus strain Cork
Q9W959 81 CNPGWGT 87  Brazilian caprine lentivirus
Q65930 81 CNPGWGS 87  Caprine arthritis encephalitis virus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap