1FXK


Conserved Protein Domain Family
Prefoldin

?
pfam02996: Prefoldin 
Click on image for an interactive view with Cn3D
Prefoldin subunit
This family comprises of several prefoldin subunits. The biogenesis of the cytoskeletal proteins actin and tubulin involves interaction of nascent chains of each of the two proteins with the oligomeric protein prefoldin (PFD) and their subsequent transfer to the cytosolic chaperonin CCT (chaperonin containing TCP-1). Electron microscopy shows that eukaryotic PFD, which has a similar structure to its archaeal counterpart, interacts with unfolded actin along the tips of its projecting arms. In its PFD-bound state, actin seems to acquire a conformation similar to that adopted when it is bound to CCT.
Statistics
?
PSSM-Id: 397237
Aligned: 35 rows
Threshold Bit Score: 69.9692
Threshold Setting Gi: 1175932
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1FXK_C  13 YQSQVELIQQQMEAVRATISELEILEKTLSDIQGk--------dGSETLVPVGAGSFIKAEL-KDTSEVIMSVGAGVAIK 83  Methanothermobacter t...
Q20070  23 IHPKIATEEKEFKKLQKQCEEYAKLKFTCQRLLNea------pkTTEGKTELGQRVFMNIEV-RDTKHVVVKLCDDVYVE 95  Caenorhabditis elegans
O94307  25 LDSELEYLSTSYGQLGRAQLKFRECLANVNDAVRae------ndGKEVLVPLTSSLYVPGKLnLGNSKLLVDIGTGYYVE 98  Schizosaccharomyces p...
Q04493  23 FDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQag------neGQKLLVPASASLYIPGKI-VDNKKFMVDIGTGYYVE 95  Saccharomyces cerevis...
Q9VCZ8  31 FEQEITNVQDSLSTLHGCQAKYAGSKEALGTFQPnw-------eNRQILVPLTSSMYVPGRV-KDLNRFVIDIGTGYYIE 102 fruit fly
Q7XD74  24 TDLEVNLLQDSLTKIRSAATRLENASAALHDLSLrp-------kGKKMLVPLTASLYVPGTL-DDSEKVLVDVGTGYFIE 95  Japanese rice
P57742  25 ADLEVNLLQDSLNNIRTATVRLDAAAAALNDLSLrp-------qGKKMLVPLTASLYVPGTL-DEADKVLVDIGTGYFIE 96  thale cress
P43573   8 VESTLKNLQDKRNFLSEQREHYIDIRSRLVRFINdnddgeeegeGQGMVF---------GDIiISTSKIYLSLGYEYYVE 78  Saccharomyces cerevis...
Q966M4   9 CNAAKARLEVETECRRIIADNYEKVLERAKEYSKk--------lEAPILAKICEVGYFCGAHvVRTNQVTMEMGANYYGE 80  Caenorhabditis elegans
Q9W148   8 LLQALQTNASETERWEAFKRDNESTIRNLDKFAKn--------lSVEVMVPIGRKALMPGEL-IHTNELLVGHYEGYFSA 78  fruit fly
1FXK_C  84 KNFEDAMESIKSQKNELESTLQKMGENLRAITDIMMKLSPQAEELL 129 Methanothermobacter thermautotrophicus
Q20070  96 MKLQDAIKTCDRKMDSLKNMMEKLQKSTNKLKTDLTMLLATMDMPY 141 Caenorhabditis elegans
O94307  99 KSAGEATEYYKRKCEYLASSIENLNNAIDAKSVQIRAVQNIMQQKA 144 Schizosaccharomyces pombe 972h-
Q04493  96 KSAEAAIAFYQKKVDKLNKESVQIQDIIKEKTQYSLSIEAQIRQAA 141 Saccharomyces cerevisiae S288C
Q9VCZ8 103 KDLEGSKDYFKRRVEYVQEQIEKIEKIHLQKTRFYNSVMSVLEMKQ 148 fruit fly
Q7XD74  96 KTMTEGKEYCERKINLLKSNFDELVEMATKKKNIADEMGRLLQAKL 141 Japanese rice
P57742  97 KTMDDGKDYCQRKINLLKSNFDQLFEVAAKKKSVADEAGMVLQAKV 142 thale cress
P43573  79 KTKEEAITFVDDKLKLMEDAIEQFNLKIEEAKKTLDNLNHMEDGNG 124 Saccharomyces cerevisiae S288C
Q966M4  81 CSIHTAEKILDRRVSEMRRQREEGLDSIRMLDDKIKFAQDNFSSVS 126 Caenorhabditis elegans
Q9W148  79 CSSHKAKEICQYRLKLAEEQLKKLAVENDLWQKKLHTPFAEGAVPS 124 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap