Conserved Protein Domain Family
DUF229

?
pfam02995: DUF229 
Protein of unknown function (DUF229)
Members of this family are uncharacterized. They are 500-1200 amino acids in length and share a long region conservation that probably corresponds to several domains. The Go annotation for the protein indicates that it is involved in nematode larval development and has a positive regulation on growth rate.
Statistics
?
PSSM-Id: 397236
Aligned: 17 rows
Threshold Bit Score: 454.11
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O62436  78 TALQSQKCNIPKLEINGSEVINFFKTHAPLEcqkknsiednwvFINDEAIIrFTEKRAKAKCKIQYFSRVDDNnNKYEEP 157 Caenorhabditis elegans
Q9VF91  73 KPVERINCGEGMDWVMCEKSICFVRPEIASS------------HEDVICSY-TDIIRKSDYKVRFGQSLRMKEpYVLQAS 139 fruit fly
Q19486  79 SKPSPLVCSTMQVQAVKSFNNGILTFEPQVIk-------------NARCYK--TGIRHDENVTDLDVIYEKPVpLNLTHT 143 Caenorhabditis elegans
Q9VKK3  98 KPRPYS-CNRALIRTSDTIP---GQLHLNLEasellayynisdLSSVNCNY-TEVKRKTDSSNTHSPAVSFK----LDKV 168 fruit fly
Q9V9Q1  66 RGLRRDFCASNLNLTSFS-NCTYNYLRTEVNmelakarfgvetLESFKCMY-YAMERHTDFDNRYLYSREFEL--LTDGN 141 fruit fly
Q9V9P7  68 EPVNKLRCRMTQLLTAITQD---GSNFLEAKri----------sEDLSCRYwLKSGHTRNHSGHYTAYGHFDLkRGATRK 134 fruit fly
Q9VGG4  77 TPMPSSACPMIKLMKPQSID-GMNYLYLIASakelwkklgvrrLSDIFCAY-KRFVRFNDFVNIYFESTLFRF-SKLRNF 153 fruit fly
Q9VQH3  74 EPIEPVLCRMEQLMVAETIG-DRNYLVRNISrhg------ilsWRQVSCIY-REFVRVDDAHNKYISLKFFKL-TDRTRY 144 fruit fly
Q8SY05 180 KKHSYIVCDKSRDMITVNYNVTDSTYRLHKNe-------------NSTCCF-KQILRAGTSANADHKYKLGPC-VEFHQD 244 fruit fly
O18062  82 EYNPARNCYKNYVQWTELVN---STWRIVKDg--------------ANCLA-RCFSGIGGSKNVKIGPWMKPG------- 136 Caenorhabditis elegans
O62436 158 VEVLDGdrmngSDYATISCIQ-GFQKWKsilwdVNDEPEIHERa----RKMRK--------EQADP-EKKPYNVYFLGFD 223 Caenorhabditis elegans
Q9VF91 140 DFVKVV-----CRSSSGESWF-GMAHGIrdtvpRPPASNFSPNl----AVLPPeavaqaqqQMQDGaTAPIYNVLMFGFD 209 fruit fly
Q19486 144 SSIKIS-----DEVFQITCES-DNLLKS-------EIFKYHYT-----QIVPKssn--iknKVIEQsTSDFPSVIMIGLD 203 Caenorhabditis elegans
Q9VKK3 169 MKLPLS-----SEFICMWCYD-SLDKLF-----YKDCHFFAVDkp-riRPPLKtgtdrvsfNKSKE-EQERLSVMILGMD 235 fruit fly
Q9V9Q1 142 NTIEPH-----ADIIRAECFI-NATSIY------NGVHFYVHPtdewlRTAQGlp-----pLKLAS-DVGSLSVLIVGLD 203 fruit fly
Q9V9P7 135 IKIGTG-----EQIVRIRCSD-KFKASK-----YHDVLYFLS------PPDPK--------LMSTE-SSEKLSVMVLGID 188 fruit fly
Q9VGG4 154 TKVDSG-----NITLRVWCWM-DYGRLV-----YHDVFIFLPF-----PNPQKv-------NNSAP--VKRLSVLILGID 208 fruit fly
Q9VQH3 145 LEVGTG-----LQHIRTWCWV-DFGRII-----FHDVMYFLP------PLPQAt-------NRSTEhQKRKLSVMILGVD 200 fruit fly
Q8SY05 245 FLVPTE-----VSAMITYCRRpPFDKVS-----QKDAFSFVHP-----RKDQIe-------NPTTP-HRRRPSVLLWGID 301 fruit fly
O18062 137 ---HVD-----CEFLETVCWE-DNIEVY----------GHIHT-----QIIPR--------KASPTkFKDAPNVFIFTID 184 Caenorhabditis elegans
O62436 224 SLSQMSFRRKLPQTVKFLEeTLGSVVLNGYNIVGDGTPQAFIPILTAq------tETELPLTRKRY--KNANYVDDVYPF 295 Caenorhabditis elegans
Q9VF91 210 SLSRNAFIRKLPRTYEYLTqQLGATVLKGYNIVGDGTPQALVPLLTG--------FTELELPETRKr-LSGAGSVDSYPM 280 fruit fly
Q19486 204 SMSRGNFVRQMQKTYKYMK-EAGFIDMEGHMKIHDNTYGNLLAILTGk------rGVGVKEFSTEIn-ESWHIAFDEFDF 275 Caenorhabditis elegans
Q9VKK3 236 SLSHLNFLRQMRRTANYVRkHLSHVEFWGYNKVGDNTFPNLVPLLSG--------LDDQELNLACT--PKTLRSYDRCSF 305 fruit fly
Q9V9Q1 204 SISQMHFHRSMARTANFLL-SLPHVELKGFNRLGEDGFDSLMPLLSG--------LSGQELKDVSS----NLSSLDSCPF 270 fruit fly
Q9V9P7 189 SVSHMHFVRYFPLVMAFLE-NHPHTKFFGYSRVGLDANANLVPFLGG--------KSSRAAG--------SDILSDEKAW 251 fruit fly
Q9VGG4 209 SISHMHYQRYFSRVRDLIE-GLPHTELWGYNRVGQNSYPNLIPLLSGq------sVDEVEAKSGCYg-ASGGTNFDRCHL 280 fruit fly
Q9VQH3 201 SISHMHYMRYFHRVADFIE-HLPHTEFWGYNRVALNTYPNLIPLVSGl------sVSEMEAS--CY---HDELNFDKCNF 268 fruit fly
Q8SY05 302 SISRMNLELTMPRMYEYLN-NQHWFELQGYNKMGDNTFPNLMAVLTG--------FNKTYANARCH--PEKVRGLDACPF 370 fruit fly
O18062 185 AMNTGMAKRSFPKLLSYFKnEFQMIEFPFVNKVGENSRPNGLPLWFGksieggrrVTGDDVEVDWDwnQYCETYLDNSSH 264 Caenorhabditis elegans
O62436 296 IWKNYSDKGYVTMYAEDAFSIGTFTYR--LKGFRQQPTDHYTRTLFEEVEKLNDR------N----CIGSIPLHRMWLQN 363 Caenorhabditis elegans
Q9VF91 281 IWKDFARLGYMTSFNEDLPNVGTFTYR--MTGFEAQPVDHYLRTYYVQAEHMAAEsk---pN----CIGHQPDHITMLEY 351 fruit fly
Q19486 276 IWKTFSDNGYATLFAEDRPDIGTFTYKnmLEGFLKQPTDHYIRPFWISAFWSLISrrs-----vasCYDSTPQHKIQLKY 350 Caenorhabditis elegans
Q9VKK3 306 IWKRYQQLGYRSIFAEDVAMLSAFNYN--QNGFRKQPTDYYLRPMIMEMEKTVAFkkdlnmHl---CMGSRRTADVLLEY 380 fruit fly
Q9V9Q1 271 IWKVFQKAGYETGLGEDNIDKSLFVKG-----FRKPPTDFYLRPALLEMWLKTRTdglfgtH----CNEKDNYAMVLREF 341 fruit fly
Q9V9P7 252 LWDSFKMEGYSTAYGEDNAKGILSNRNg-DKELPKSPVDFDLTPVIVEMNNHTRYsi--dlKemihCTAGRKFQDVLRDF 328 fruit fly
Q9VGG4 281 LWHDFQAAGYATIFGEDSRVAGTFTYV--RPGFKKRPTDFYLRSVINEIHMRSTYfargplEi--kCSGDRVYHHVLYDF 356 fruit fly
Q9VQH3 269 LWNEFKRAGYSTIFAEDTDTAGLFIYR--KRGFQKQPTDIYMRPLMTEIESHSLYrt--tfDl--kCTGHRLYGEFYYDF 342 fruit fly
Q8SY05 371 IWKDFKDKGYTTAFAEDWSKFSTFDYS--SRGFFNPPTDVYGRPLVLAVEKELTIlqrgqmPy---CLGRKPASEYIYDM 445 fruit fly
O18062 265 IFKDFKDHGYATMLFEDWEGNVVDSWPt-CVGFEEPPTDHTFRPFASVSETHGMEitkrhlS----GKFCRETHHAIMEL 339 Caenorhabditis elegans
O62436 364 GRQFMKKYEDVP----RFLLMHQSLLSHDDINLVGVEDEDLSAHLSHMNDEGLFDDSVVIVMADHGHRFAKLRDTHQGQL 439 Caenorhabditis elegans
Q9VF91 352 TKNFMLKYRDAP----RFAFSFHGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIMMADHGNRFAEVRATLQGKQ 427 fruit fly
Q19486 351 LEEFLEKYDKKR----KFAFWWSQDMSHGFLNLIGKVDDDFEKFFKNNEKR--MEDSIIIVFSDHGHRYDKIRETVIGRI 424 Caenorhabditis elegans
Q9VKK3 381 MKKLVPRMSRDL----YFSFFWTVALTHDYFNFPSLLDEAMLQQLMQLQDSGLLNRTVVMLLSDHGLRWGSFRRTYQGMM 456 fruit fly
Q9V9Q1 342 LFKMLPHHTSHR----FFTFLWWTQGIDHLFNYGRKLDQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKV 417 fruit fly
Q9V9P7 329 VLQLVPYMQGMP----FFSFFWQSQGVQEYYEYAWHLDLSYMMLLKKLLDADILNNTLLFLMSDHGLRAGEYRMSLQGMK 404 fruit fly
Q9VGG4 357 IYRLLPHMQARMydrgFFAFFWQTMGVHDYFQYGERADWEYYRIMRALKRRKILERTLVLIVSDHGLRYGPFVDTFQGMR 436 fruit fly
Q9VQH3 343 VSKLIPHMERQL----FFSFLWNMHGIHDVFPYAKFVDKDYLSILTRLHEKGVMENTLILFMGDHGLRFDKFARTAPGQH 418 fruit fly
Q8SY05 446 GVQFTMVNRNST----FFGMFWTNTFSHNDFSMPSAMDERMVKYMRTLDKNGIMDNTIIIFFSDHGSRFGPLRNLDSGFV 521 fruit fly
O18062 340 LEQGIEAYKDRP----IFSWLWLAWVAHDWIDGAARVDEYLVNYFKKHNNM--FDNSFVMFVSDHGLRTGKHMRTEIGAF 413 Caenorhabditis elegans
O62436 440 EERMPFFSISLPKQLRntEKGRKMEQNLRENAEKLTSPFDIHASLMDILNLSELGENELNR-MQDASS------------ 506 Caenorhabditis elegans
Q9VF91 428 EERLPFFSFVFPESFK--KRFPQEYKNFLANEHHLTTPFDIHATLKHVIQLQTAVDQFGEInDPKTETsppgiriselar 505 fruit fly
Q19486 425 ESRMPFHSIRIPDGIK--KKYPQIVENLMVNSKLMTTQFDVNDSLRKIATGKVGEKWTQTD------R------------ 484 Caenorhabditis elegans
Q9VKK3 457 EERQPLMMLLYPPWMT--ERYPEAIANLRLNARRLTTPFDVHATMLQLLNLHNLEADQLQRrSTEMDEpds-------tl 527 fruit fly
Q9V9Q1 418 EESQPLAILCYPRWLE--ERYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQrRVDLWAmgk-------di 488 fruit fly
Q9V9P7 405 EESQPLMVAIYPEWLK--RKYPLAVGNLESNAHSLITPYDLRETLADVIALGQLKDANIEVsMKRLQShpp------nrl 476 fruit fly
Q9VGG4 437 ETSLPIMVAIYPRSLR--ERFPLAFANLEANAHRLVTTYDLHETLKDVVDLENLSDERILNrTLRLRN------------ 502 fruit fly
Q9VQH3 419 EMSQPLLIAIYPEWLK--RRFPLAMSNFERNARSLITTFDLHETLKDVIHLDRLTDANVRNrTLYLTN------------ 484 fruit fly
Q8SY05 522 EERLPFIYIRVPRWIR--EKYPKLLRNLQMNKNRLTSPYDIHATLRHILELDTPKDKLPRP----DGC------------ 583 fruit fly
O18062 414 ERDNPFLSISIPKRFR--ATKFGILETLNFDSKQLQTHFDVRATLLDILKFQPTSKFMDRQqKNIPDE------------ 479 Caenorhabditis elegans
O62436 507 KRSLSVFKPIPVD-RTCSQAGIEPHWCTCLSWKDAMDTGEdr-kLTRRIANAVVREINKEIVAE--------KDLCAPLS 576 Caenorhabditis elegans
Q9VF91 506 GRAMSLLDPIPSN-RSCADAYIEPHWCACLNWLPLQLNDSrytgIILKAAQSIVNAINLATVEQ--------RQYCAPLE 576 fruit fly
Q19486 485 KRSYSYFDPFPKR-IGCYEAGIPSDFCPCFSEIEIPKSEAkeaaVELMRIVNDLLENTEKTEEYepdskeltEYMCTPME 563 Caenorhabditis elegans
Q9VKK3 528 PRGISLFLPIPAA-RTCEQAGIAAHWCTCHQRQELQTNDP----RVQRAARYLVRLINNRLKD---------SSQCRTLY 593 fruit fly
Q9V9Q1 489 PRGISLFLPIPDH-RDCFLAAIPTANCLCQQPRNVSTSDG----YVQRAARLIIRNLNKMIHTH--------TPPCKTLY 555 fruit fly
Q9V9P7 477 PRGISLFLPIPDH-RTCDLAHIPSLFCFCRELTEVPTDDG----LVLRSSRFMVESINQLIKP---------FGQCRQLK 542 fruit fly
Q9VGG4 503 NHNVSLFLPIPEE-RSCFSARIPLHYCQCDGYVKIPWNVR----SIQRIAKLAVANINRLLAP---------YPQCEQLE 568 fruit fly
Q9VQH3 485 ERGISLFLPIPQN-RNCKTAEIKQHYCLCNELKSVSTHES----AIQEAASFAVDRINELIKP---------YPQCRVLS 550 fruit fly
Q8SY05 584 SSCHSVFEEVDWS-RNCSQAGIEDHWCACNSFSDVPTTDP----SARSMSTQLVEAINEYVASKk------gTKRCSRLK 652 fruit fly
O18062 480 -KGHSLIRKQPDFpRTCATLPIPQQWCICQVDKFEIHNET----LKNHLGEKLLNHVHRKLKKLn------vSEICETFR 548 Caenorhabditis elegans
O62436 577 LAKII 581 Caenorhabditis elegans
Q9VF91 577 IHRVN 581 fruit fly
Q19486 564 IQNVE 568 Caenorhabditis elegans
Q9VKK3 594 LNSIL 598 fruit fly
Q9V9Q1 556 LDRVL 560 fruit fly
Q9V9P7 543 LEMVL 547 fruit fly
Q9VGG4 569 LLNVE 573 fruit fly
Q9VQH3 551 LQSVR 555 fruit fly
Q8SY05 653 LNRIS 657 fruit fly
O18062 549 LSKVT 553 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap