Conserved Protein Domain Family
Transposase_21

?
pfam02992: Transposase_21 
Transposase family tnp2
Statistics
?
PSSM-Id: 397234
Aligned: 8 rows
Threshold Bit Score: 359.006
Threshold Setting Gi: 548830308
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_015164188 189 DGLMRHPRDGEAWKTFDRTHSGFASDPRNVRLGLASDGFNPFGTMSTTYSIWPVFLIPYNLPPWMCMKHTSFILSMIIPG 268 potato
Q0J7A0       295 DNELSHPADGEAWKDFDRKYEWFANDARNVRLGLATDGFNPFGKMSSSYSMWPVFLIPYNFPPWQCMEQSNFMMCLLILG 374 Japanese rice
ERM93430     185 DGVLRHPVDGLAWKDFDAKHPEFARDPRNVRLGLAADGFNPFGNMSLAYSMWPVVLANYNLPPWLCMKDNYFLLSTLIPG 264 Amborella trich...
ERM93394     113 DGVLRHPADAEEWKQFDRLHPSFAVEPRNVRLGLATDGFNPFGNMSNSYSLWPVICVPYNLPPWKCMSSESLLLTLLIPG 192 Amborella trich...
3_pfamImport   1 DGLIRHPADSAQWKYFDELHEDFAKDNCHFRLGYGAYGFNPFRSNNANYSVWPVILIPYNFPPWMCMEQS-FFLTLLIPG 79 
ERN01801     222 DGKLRHPADSQAWKKVNYINPEFKSEPRHIRLGLSADGVNPHRSLSSRHSSWPVFLVMYNLPPWLVMKRKFNMLSLMISG 301 Amborella trich...
XP_006664486 199 DGMLRNPADSMQWRNIDRIYPQFAEDSRNMRVCLCTDGMNQFGDMSSRHSTWPVLIANYNFPPWLCFKRKYIMLCLLIQG 278 malo sina
XP_015694165  19 DGLLRHPADSPAWKHFDCKHPKFSEDSRNIRLALATDGFNPFRSMNCSYSIWPVILIPLNFPPWICMKQPNFILSLLIPG 98  malo sina
XP_015164188 269 KQMPGNNIDVYLQPLVKELCELWNdGVETFDSSLNETFRMHAALMWTISDFPGLGILSGWNTHTGFACPTCNFDTEPCRL 348 potato
Q0J7A0       375 PTCPGKDMDLFLQPLVEELLNLWS-GVPTLDALTGKEFDLHAAIIWCIHDYPALSTLSGRVTRGYYACVCCDKNPCYKRL 453 Japanese rice
ERM93430     265 AKSPGKDMDIFLRPLVDELKELWNnGVPTRDSSTNSMFTMRAALLWTVNDFPARSSLSGWSGQGYKACPTCNEDTTSIRV 344 Amborella trich...
ERM93394     193 PSSPGKDIDVFMRPLIDELKQLWEtGVETRDAYNGTVFSMRAAVLWTINDFPAYALMSGWSTKGYMACPTCNEHTPSIGL 272 Amborella trich...
3_pfamImport  80 KHAPDSDMDVYLEPLIDDMVDMFLhGVRTYDASKEEFFNLKAVILWTIHDFPGLVYTTGYTTSGEGACPECHSDTCSLML 159
ERN01801     302 PQQPGHNIDVYLEPLIDDLIELYEnGVQVYDGFKKEFFNLKAVLLWTVSDFPAYSNLSGLSTKGYEGCPICCTNTSARRL 381 Amborella trich...
XP_006664486 279 PRQPGNDIVVFLEPVGDDLEILWNeGVQTSDSYGREQFNLRVLLFGTINVWPALGNLSGQSIKRMNAGINCKKNTRSLCL 358 malo sina
XP_015694165  99 PYSPGKDMDVYFEPLVDDLLEIFEgGVITYDASRSENFQLRAAIIYTITDFPGLGYAAGCVTSGKLACPHCNSQTCSIRL 178 malo sina
XP_015164188 349 VhsKKWCFMGHRRFLRRNHRFRFnRVRFNGSTEERNPPIKLSGSDILRQIA 399 potato
Q0J7A0       454 R--NKICYIGHRRFLPVDHIWRR-KKDFNGQTEERAQPEEFTQDELMQQLA 501 Japanese rice
ERM93430     345 I--GKTSYVGHRRFLPSNHAMRR-DTRFDGKVERRPPPRRFTCEEILSQVN 392 Amborella trichopoda
ERM93394     273 N--SKIGYVGHRRFLEMSDPRRR-SKKVHGKTEKRAPPPVMTGDDILTQLd 320 Amborella trichopoda
3_pfamImport 160 NngSKTCYMGHRRFLHEDHPFRSnTHSFDGIAEHRPAPIPLSGSEIVAQTK 210
ERN01801     382 AngHKMCYMGHRRYLPANHPDRRkKKAFDGTEEGDMAPLPLSGEQILQQVQ 432 Amborella trichopoda
XP_006664486 359 KhsRKMVYLGHRRWLPIRHRYRRmKRSFNGKNELLPAPKTLTGKEVYDMVQ 409 malo sina
XP_015694165 179 RngGKTCYMAHRRFLDANHKFRFyEASFDGNVELRSAPKPLTGEEILDQTK 229 malo sina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap