Conserved Protein Domain Family
LEA_4

?
pfam02987: LEA_4 
Late embryogenesis abundant protein
Different types of LEA proteins are expressed at different stages of late embryogenesis in higher plant seed embryos and under conditions of dehydration stress. The function of these proteins is unknown.
Statistics
?
PSSM-Id: 111833
View PSSM: pfam02987
Aligned: 26 rows
Threshold Bit Score: 32.2805
Threshold Setting Gi: 119127
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q06431 202 KDYAAEKAKEAKDKTVGKASEYKDYAAEKAKETKDSALGKAEEY 245 European white birch
Q39871 297 AEATANKAGEMKEATKKKTAETAEAAKNKAGEIKDRAAETAEAA 340 soybean
Q39871 348 AEVTKNKALEMKDAAKDRTAETTDAAKQKTAQAKENTKENVSGA 391 soybean
Q1XI26 252 KEAAKDKIGHAVDVTTDKLGQAKDATAEKLVQAKDATAEKLGYA 295 sleeping chironomid
Q1XI26 413 KDKTADKLGQAADKTKEKLVEAKDVTADKLGHAKDVTADKLGRA 456 sleeping chironomid
Q9ZPW6 322 KDYAYKKAGNAKDIAYEKAQDAKDFAYDKAGYGYDKAGDVIRMA 365 thale cress
Q9ZPW6 238 MDSGYDKAGDAKDMAYEKAGIVKDMAYDKAGDAKDVAYEKAGIA 281 thale cress
Q9ZPW6  77 ENYAYDKANYVKDSAYDNAGYAKDFAENKAEYAKDFAYDKAGDA 120 thale cress
Q7P280  15 KDTVADKAKELKDEAVTKVGELKDKATEKAGELKDKVVDKAKEL 58  Fusobacterium nucleatum subsp. vincentii ATCC 49256
Q06431  78 TEETAESTRESGENAAEKARKTKDSAAEKTRETKKCAAEKAKEY 121 European white birch
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap