3QXE


Conserved Protein Domain Family
NHase_alpha

?
pfam02979: NHase_alpha 
Nitrile hydratase, alpha chain
Statistics
?
PSSM-Id: 397226
Aligned: 36 rows
Threshold Bit Score: 251.019
Threshold Setting Gi: 514696708
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3QXE_A            40 VKALESLLIEKGLVDPAAMDLVVQTYEHKvGPRNGAKVVAKAWVDPAYKARLLADGTAGIAEL-----GF---SGvq--- 108
jgi:Dshi_1849     26 EIALRELLIEKGVLTPAEVTAQVTQMDAR-SPANGAAVVARAWTDPAFRARLLADGAEACREM-----GYdigTL----- 94  Dinoroseoba...
WP_013046600      27 ESALRDLLIAKGVITQSMMRQQMDQTASQ-SASVGAEIIARAWTTPQFKDALLKNPKEALSNS-----GYd-vSGm---- 95  Candidatus ...
Q1ATN4            22 IRAIESLLVEKGVLTEAEIQDQIEYMDSR-SPANGARLVARAWVDPEFRRRLLADTKAAALEL-----GIdasGPv---- 91  Rubrobacter...
jgi:Pse7367_1909  44 THAIERILEQKGYFTAAEVRKEIEREDSV-TPMLGARLVARAWLDPEFKARALVDGKAACREL-----DIdtv------- 110 Pseudanabae...
WP_011731167      29 EIALRELCIEKGIFTAEEHRRFTEFAEQI-GPTPAARLVAKAWLDPEFKQLALTDALAASKAV-----GVdwlEPtgfgt 102 Mycolicibac...
Q5YY20            26 ETAIRELAIEKGLFSQEDHRRFSEWAQAV-GPHGGSTLVARAWLDPDFKARLLADGTETCKEI-----GIdwrDPtgsgt 99  Nocardia fa...
jgi:Rvan_0450     44 EAALSELLIAKGLIKAVDIQRAVEALDAG-SPAYGARLIARAWVDPGFKARLFENANLAAREF-----DCdagPG----- 112 Rhodomicrob...
WP_011941972      12 LAGLRSLLAAKSIASADEIAERIRITDGG-GPAQGARMVAKAWTDPDYKALMLADGARAAELLdipmrGLp--------- 81  Acidiphilium
XP_004995924     206 ADALVAALVARKVIAMPELNAAVSDIEAMgANMEGARLVVRAWKDAAFKSLLLQDAAAAAAQL-----GIatsNYhadgp 280 Salpingoeca...
3QXE_A           109 ---geD-------------MVILENTPAVHNVFVCTLXSXYPWPTLGL-PPAWYKAAPYRSRMVSDPRGVLAE-FGLVIP 170
jgi:Dshi_1849     95 -----N-------------LIAVENTPEVHNVIVCTLCSCYPRNLLGL-PPDWYKSRAYRSRTVKDPRGVLAE-FGTELP 154 Dinoroseoba...
WP_013046600      96 ----pD-------------LCIVENQPDIHNVVVCTLCSCYPRFMLGP-PPEWYKSAAFRSRIVQEPKDVLLE-FGLDLN 156 Candidatus ...
Q1ATN4            92 -----E-------------FVVVENTPEVHNLIVCTLCSCYPRAILGR-PPDWYKSFEYRSRAVREPRAVMRE-FGHEPP 151 Rubrobacter...
jgi:Pse7367_1909 111 --eikN-------------LQVVENTEHIHHVVVCTLCSCYPRAILGYhPPSWYKSTAYRNRVVIDPRGVLEKeFGTIVP 175 Pseudanabae...
WP_011731167     103 psdftA-------------FKILEDTPTLHHVIVCALCSCYPRPILGN-SPEWYRTPNYRRRLVRWPRQVLAE-FGLYLP 167 Mycolicibac...
Q5YY20           100 psdytY-------------FYVLENTPEVHNVIVCTLCSCYPRPVLGM-SPDWYRTPNYRRRLVRWPREVLAE-FGLHFP 164 Nocardia fa...
jgi:Rvan_0450    113 -----R-------------LIVVENTPHLHNLVVSSLGVSFPRALLGR-APAWYESAAYRSRAVREPRQVLAE-FGADIP 172 Rhodomicrob...
WP_011941972      82 ------------------pLGVVENTPGIHHLVVCTLCSCYPRAVLGY-PPFWFKSAAYRARAVRDPRGLIAE-WGTELP 141 Acidiphilium
XP_004995924     281 saesqHaehshaypdghtiLTVVENTPHVHNLVVCTLCSCYPAAVLGL-SPSWYKSLAYRCRAVRDPVRLLREeFGVSIP 359 Salpingoeca...
3QXE_A           171 ANKEIRVWDTTAELRYMVLPERPAGTEAYSEEQLAELVTRDSMIGTG 217
jgi:Dshi_1849    155 RGMTVRVHDSTADMRYIVIPQRPAGTETLSPEALAALVTRDGMIGVT 201 Dinoroseobacter shibae DFL 12 = DSM 16493
WP_013046600     157 ETTKIRVYDSTADIRYMVMPLRPDGTEHMSADQLKPLITRDTMIGVA 203 Candidatus Puniceispirillum marinum
Q1ATN4           152 EGVRVAVHDSTADVRYMVLPMRPEGTEGMSEEELAALVTRDSLIGVS 198 Rubrobacter xylanophilus DSM 9941
jgi:Pse7367_1909 176 AEVEIRVMDSNADTRYLVIPNRPPNTDGWAEEDLIKLVTRDSMIGVA 222 Pseudanabaena sp. PCC 7367
WP_011731167     168 DDVEVRVEDSNQKHRFMVMPMRPEGTEGWTEDQLAEIITRDCLIGVA 214 Mycolicibacterium smegmatis
Q5YY20           165 PEVEVRVHDSNQKSRFMVLPMRPAGTEGWTEEQLAAIVTRDTMIGVA 211 Nocardia farcinica
jgi:Rvan_0450    173 SYVEVRVHDAAADHVYLVLPMRPAGSEAFLEEDLAALVTRESMIGVQ 219 Rhodomicrobium vannielii ATCC 17100
WP_011941972     142 AATAIRVVDSTADYRWMVLPMRPAGTEGWSEAELAAIVREGDMIGVT 188 Acidiphilium
XP_004995924     360 PHQHVRVHDSTANLRYLVLPMQPAGTEDWTEEQLLPLVTRDAMIGAG 406 Salpingoeca rosetta
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap