3SXT


Conserved Protein Domain Family
Me-amine-dh_L

?
pfam02975: Me-amine-dh_L 
Click on image for an interactive view with Cn3D
Methylamine dehydrogenase, L chain
Statistics
?
PSSM-Id: 397222
Aligned: 15 rows
Threshold Bit Score: 180.657
Threshold Setting Gi: 400261040
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3SXT_E                 16 QDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASXVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGEL 95  Paraco...
WP_003625995           81 QAKDANACDYWRYCAIDGNLCSTCGGGVHSCPPGTAPSPTSWIGSCYNPQDGNSYMIAYRDCCGQDSCNEVTCLNTDGDQ 160 Acetob...
WP_015458198           69 QTKDDTECNYWRYCAIDGSLCTCCGGTTSMCPPGTQPSLTSWVGTCLNPDDKRLYLIAYRDCCGTSGCGRCRCDNTEEAT 148 Sphing...
WP_025292992           68 QITDDTKCDYWRYCAIDGALCTCCGGGIHSCPAGAEPSPVSWVGTCINPADGKAYLIAYRDCCGKPACGQCPCDNTDRET 147 Sphing...
jgi:Swit_3251          53 ETGDPQSCDYWRYCAIDGFLCSCCGGSTSSCPPGTEPSPITWVGTCRNPADGKDYVISYNDCCGKSGCGRCMCNRNEGDK 132 Sphing...
WP_012050543           68 DPGDQTQCDYWRYCAIDGFLCSCCGGTASACPPGTEMSPITWIGTCLNPADGRSYIISYNDCCGKSSCGRCLCNRNESDR 147 Sphing...
calssnu:BYI23_B006040  59 aSDDPLSCDYWKYCAIDGWLCSCCGGTSSSCPPGTTPSPITWIGTCRNPHDGSDYIVSYNDCCGKTSCGRCFCNRNEREK 138 Burkho...
HuoZJU:KKY_2942        70 pDGDQTDCEYWRYCALDGNLCNDCGGAIDQCPPGSEASSVAWVGTCANPNDGRDYLVSYNDCCGKASCSGSFCFTSEGER 149 Pelagi...
jgi:Saro_3821          59 eQGDPTSCDYWRYCAVDGFLCACCGGSASSCPPGTEPSPITWLGTCRNPADGRNYVISYNDCCGKAACGRCNCSRDEGAT 138 Novosp...
BAN48077               60 aEGDSNSCDYWRYCAIDGFLCGCCGGSPTSCPPGTVRSDITWIGTCRNPADGKDYVISYNDCCGKGNCGRCVCQRDEGDT 139 Pseudo...
3SXT_E                 96 PVYRPEFANDIIWCFGAEDdAMTYHCTISPIVGK 129 Paracoccus denitrificans PD1222
WP_003625995          161 PSYRPMANNDIIWCFGTGT-SEMYNCSTAAVIGK 193 Acetobacter
WP_015458198          149 PAYRPSGNNEIIWCFGT-S-SMAYHCSTAALVGV 180 Sphingomonas sp. MM-1
WP_025292992          148 QLYNPQLNNDVIWCFGT-S-SMEYHCSTAVLVGA 179 Sphingomonas sanxanigenens
jgi:Swit_3251         133 PIHQPSGSNDINWCLGTQV-GMIYNCSTAVVLGA 165 Sphingomonas wittichii RW1
WP_012050543          148 PMVRPQSNNDINWCLGTES-GSVYNCSTAVILGT 180 Sphingomonas
calssnu:BYI23_B006040 139 PLYKLSLNNDINWCM-ANG-NSNYHCSVSVLLGA 170 Burkholderia sp. YI23
HuoZJU:KKY_2942       150 PGYRMGLYNDINWCM-ANA-SKGYHCTVAVVVGL 181 Pelagibacterium halotolerans B2
jgi:Saro_3821         139 PVYQPTTANDLDWCLGTQA-GVAYHCSLSVVTGP 171 Novosphingobium aromaticivorans DSM 12444
BAN48077              140 PLYRPQSSNDINWCSGSHA-DMPYHCSLSVVIGv 172 Pseudomonas resinovorans NBRC 106553
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap