1QD1,1TT9


Conserved Protein Domain Family
FTCD

?
pfam02971: FTCD 
Formiminotransferase domain
Statistics
?
PSSM-Id: 397220
Aligned: 39 rows
Threshold Bit Score: 195.88
Threshold Setting Gi: 503967256
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QD1_A       180 FLLAFNINLLST-REQAHRIALDLREQGRGKDQ-------------------PGRLKKVQAIGWYLDEKNLAQVSTNLLD 239
WP_042520159 187 FLIAVNFNLNSTsTRRANAIAFDVREKGRPVREgnpitgkkkldengkvvmqPGTLKGTKAIGWFIDEYGIAQVSMNITN 266 Prevotella pect...
CCX44789     185 FLIAVNYNLNTTsTRRANAIAFDVREKGRPKRQgpkvndpvvkdengktvmiPGTLKGTKAIGWFIDEYGIAQVSMNITD 264 Prevotella sp. ...
CDE57239     184 FLVAVNFNLNSTsTRRANAIAFDVREKGRPRREgnpitgkivrdaegnpvmiPGTLKGCKAIGWYIEEYGIAQVSMNITD 263 Prevotella sp. ...
CDA96280     192 FLIAVNFNLNTTsTRRAMAVAFDVREKGRPAREggsltgkilkdsegqtiwiPGTLKGCKAIGWYIEEYGIAQVSMNITD 271 Bacteroides sp....
AGY52971     185 FLVAINYNLNTTsTRRANAIAYDVREKGRKLREgnpitgkvvkdengkdvwiPGTLKGCKAIGWYIGEYGIAQVSMNVTN 264 Bacteroidales b...
WP_012414698 180 FLIAYNITLNTKsAKLAEILARKIRQSGGGRKL-------------------PG----VKAIGWYLPAYEAAQVSCNITN 236 Elusimicrobium ...
WP_014201250 178 lLIAYNVNLNTKdVSIAKKIASNVRESGKWEIAenge-----------rskvFGKLKSVKGLGWYIEDFQKAQVSYNLTD 246 Owenweeksia hon...
WP_013765313 186 FLIAYNVNLNTTdVSLARRIAEKIRASGHKVKDergn-----------iqriPGRCPGLKAIGWYMPSYGKAQVSMNITD 254 Haliscomenobact...
CAO80087     180 FLIAYNINLNTRdKKKASEIAQIIRESGRPARDengkllkd---engnpiyiPGLFSHCKAVGWFIESYDRAQISINLTN 256 Candidatus Cloa...
1QD1_A       240 FEVTGLHTVFEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFL-LQDEHRIRLVVNRLGLDSLAPFKPKE 318
WP_042520159 267 INETPLHKAFDEVCRCAQNRGLRVTGTEIVGLIPECALLDAGKYFLAKQQRSAgIPKEDILKIAIKSMGLEDLRPFNPEE 346 Prevotella pect...
CCX44789     265 IRTTPLHVAFDEVCRAASERGIRVTGTEIVGLIPKSCLIDAGRYFLAKQQRSAgISEEAIINIAIKSMGLDDLKEFNPRE 344 Prevotella sp. ...
CDE57239     264 IRATPLHVAFEEVCRAADRRGLRVTGTEIVGLVPRSCLLDAGKYFLRKQCRSLgISDDEIIKIAVKSLGLEDLAPFKVHE 343 Prevotella sp. ...
CDA96280     272 INTTPLHVAFEEVCRAAAARGLRVTGTEIVGLVPKRVLLETGRYYLEKQQRSLgISEDEIIKIAAKSLGLSDLKPFNPRE 351 Bacteroides sp....
AGY52971     265 ITQTPVHVAFEEVVAKAAARGIRVTGSEIVGLIPKKVLIDAGKFYLEKQQRSLgISEDEIIKIAVKSMGLDDLRPFDPKE 344 Bacteroidales b...
WP_012414698 237 FHKTSVHTVFETVKHEAGLMNIEVKGSELIGLIPKEALMQAGDFYSQTACGCEkFSESEKLQNAVKFLGLDLHADFDYSK 316 Elusimicrobium ...
WP_014201250 247 ITEAGMLDVFLATQEEAEKLGVEVTGSELVGLAPINEFHKATQHSHPGQT----FTDDEAIAAAIKFLGLDELKPFDPNQ 322 Owenweeksia hon...
WP_013765313 255 LDLTPVHEAFVACQQEAQHLGVEVTGSELIGLAPLRVFLEAGHYFAPNESGL-----DRLIEIAIVHLGLRELEGFDPAN 329 Haliscomenobact...
CAO80087     257 YKITPPHLVLEKVRELASEMGMQVTGSELVGLIPKSALVEAGKFYLQRLQESTgIPEKMIMQTAIQSMGLAELAPFDLNK 336 Candidatus Cloa...
1QD1_A       319 RIIEY 323
WP_042520159 347 KVIEY 351 Prevotella pectinovora
CCX44789     345 KVIEY 349 Prevotella sp. CAG:1031
CDE57239     344 KVIED 348 Prevotella sp. CAG:873
CDA96280     352 KVIEF 356 Bacteroides sp. CAG:709
AGY52971     345 KVIEY 349 Bacteroidales bacterium CF
WP_012414698 317 KII-- 319 Elusimicrobium minutum
WP_014201250 323 KIIER 327 Owenweeksia hongkongensis
WP_013765313 330 RILEH 334 Haliscomenobacter hydrossis
CAO80087     337 KVIEY 341 Candidatus Cloacimonas acidaminovorans str. Evry
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap