3JCM


Conserved Protein Domain Family
DIM1

?
pfam02966: DIM1 
Click on image for an interactive view with Cn3D
Mitosis protein DIM1
Statistics
?
PSSM-Id: 397218
Aligned: 19 rows
Threshold Bit Score: 189.026
Threshold Setting Gi: 75324330
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JCM_L         5 LLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIYLCDID--EVSDFDEMYELT-DPMT 81  Saccharomyces c...
Q6C5W4         5 LLPHLNTGWHVDQAILSEEDRLVVIRFGRDHDLECMKMDDHLYSVAEKIRNFAAVYVCDID--QVPEFNQMYELY-DPVS 81  Yarrowia lipoly...
Q28IH4         4 MLPHLHNGWQVDQAILSEEDRVLVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDIT--EVPDFNKMYELY-DPCT 80  tropical clawed...
KIS69303       4 FLPHLPTGWHVDQAILSEEDRVVILRFGHDTDPVCMEMDETLYKISTAVQNFAVIYLVDIT--QVPDFNKMYELY-DACS 80  Ustilago maydis...
XP_001708675  10 ELNALSNAYAVDMAIQHESARIVVVRFGLPDTAACAEMDELLAETMVRLSRMAIFYTVDRN--VVSGFDELYELEdDDFA 87  Giardia lamblia...
XP_001629610   4 LLNKLRTKKEVDNAIKSTEDKVLVLRFGREADPVCMQLDDILAKTNQALSRMADIYIVDVD--EVPAYTQYFDVTlIPAT 81  starlet sea ane...
Q6NMD4        12 LLKTLTTKEEIDRVIRDTIDEVLVLRFGRSSDAVCLQHDEILAKSVRDVSKFAKVALVDVDseDVQVYVKYFDITlFPST 91  thale cress
Q53MQ0         5 LLPTLRRKPEVDAAIRDTLDKVLVLRFGRADDAACLHLDDILAKSSWDISRFATVALVDMDseEMQVYIDYFDITlVPAT 84  Japanese rice
Q28GF9         4 LLPKLSSKRDVDHAIKTTSEKVLVLRFGRDEDHVCLQLDDILSKTSHDLSKMATIYIVDVD--KVPVYTRYFDISyIPST 81  tropical clawed...
EAY08192       4 LLTHLPSGWDVDQAIVWEKTKLVCIRFGRDTDPMCMKMDQMLASCAEKLKNFVVIYAVDII--KVPDFNKMYELV-DPCS 80  Trichomonas vag...
3JCM_L        82 VMFFYHNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETIFRGARKNKGLVVSPYDY 137 Saccharomyces cerevisiae S288C
Q6C5W4        82 VMFFYRNKHIMCDFGTGDNNKLNWVLEDKQELIDIIETVYRGASKGKGLVVSPKDY 137 Yarrowia lipolytica
Q28IH4        81 VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMIDIVETVYRGARKGRGLVVSPKDY 136 tropical clawed frog
KIS69303      81 TMFFYRNKHIMIDLGTGNNNKINWAITDRQELIDIVEVVYRGASKGRGLVISPKDY 136 Ustilago maydis 521
XP_001708675  88 LLFYYRGRRMQCDFGRFGKYKLTVVPPSTDTFIDVISELYYNAQLGRFSCTSPWQP 143 Giardia lamblia ATCC 50803
XP_001629610  82 VFFF-NGQHMKVDYSTPDHTKFIGSFHTKQDFIDLVEVICRGAMRGKLIVTSPIDP 136 starlet sea anemone
Q6NMD4        92 IFFF-NAHHMKLDSGTADHTKWVGAFHIKQDFIDVVEAIYRGAMKGKMIVQCPIPP 146 thale cress
Q53MQ0        85 IFFF-NAQHMKMDSGTPDHTKWIGSFSSKQDFIDVVEAIFRGAMKGKLIVSCPLPP 139 Japanese rice
Q28GF9        82 IFFF-NGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDP 136 tropical clawed frog
EAY08192      81 VMFFFKNRHITVDYGTGENNKMNFLLKTKQEFIDICEIVYRAASKGLGTAKSIINY 136 Trichomonas vaginalis G3
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap