Conserved Protein Domain Family
EcoRI

?
pfam02963: EcoRI 
Restriction endonuclease EcoRI
Statistics
?
PSSM-Id: 397216
Aligned: 6 rows
Threshold Bit Score: 462.76
Threshold Setting Gi: 427376111
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
HYCyano:ANA_C11060  17 SQGVVGIFGKEAKSHDIAVGQISRLVIKQLEKEFPQLSFKYKTSISKKEINEALQKLDSQLGQTLFVPNSRIKPDGGIIQ 96  Anabaena ...
WP_004916653        17 SQGVVGIFGEKAKLHDLTLGEISHLVIKQLEEEYPQLTFQYKTSIRKEEINKALRKIDGELGQTLFVPNSSVKPDGGIIE 96  Riemerell...
wustl:BD3180        17 SHGVEGIFGEEAKLHDLTVGEISHHVIAKLTEDYPQLTFRYRQSIEKKEINEALQKVDPNLGQTLFVENASIIPDGGIIE 96  Parabacte...
jgi:Syn6312_0850    16 SGGVSGIFGEEAQVHDQSVGCASTSVFEELKREYPRYQFRFRQAISKQEINEKLNSIDKRLGKTLFVKESKIKPDGGIIE 95  Synechoco...
CBL22353            16 GQGPVTIFHKDAKFHDAEVGSTSELAMIKLKNEFSMLKFRYRKNLSKKEINEALKKIDDFLGQTLFLEKARIKPDGGIIE 95  Blautia o...
CDC41040            16 GQGPITIFHKDAQIHDKEVGNTSLFVVKQLEFEFTMLTFRYRKDLSKKEINESLQKIDTYLGQTLFVESASIRPDGGIIE 95  Clostridi...
HYCyano:ANA_C11060  97 VKDDNGNWRVVLVTEAKHQGKDIENIHKGKLVGTDNNQDLMAAGNAIERSHKNISEIANFMLSKSHFPYILFLEGSNFLT 176 Anabaena ...
WP_004916653        97 VKDDNGNWRIILVSEAKHQGKDIENIRKGRLVGKANNQDLMAAGNAIERSHKNISEIANFMLLESHFPYVLFLEGSNFLT 176 Riemerell...
wustl:BD3180        97 VKDDNENWRVVLVSEAKHQGKDIENIRKGELVGKNKDQDLMAAGNAIERSHKNISEIANFMLAESHFPYVLFLEGSNFLT 176 Parabacte...
jgi:Syn6312_0850    96 VQDKDKRWRVVLVSEAKFQGKDVENIKAGVLVGKKKDQELMVAGNAIERVYKNINEIRNFMLDEYHFPYAVFLQGSNFAT 175 Synechoco...
CBL22353            96 VQDDNGKWRVVLVSEAKHQGKDIENIRAGKLVGKKNDKDLMPAGNVIERAYKNVKEIANYMLGESYFPYILFLEGTNFLT 175 Blautia o...
CDC41040            96 VKDDNGKWRVVLVSEAKHQGKDIENIIAGKLVGKKNNQDLMAAGNAIERAYKNVNEIANFMLSERYFPYILFLEGSNFLT 175 Clostridi...
HYCyano:ANA_C11060 177 ETISIKRPDGRVVTLDYDSGMLNRLDRLTSANYGMPINTNLCKNKFVKHHDKTIMLQAASIYTQGNGEKWDAKKMFDIMI 256 Anabaena ...
WP_004916653       177 ETVSIERPDGRIVRLEYNSGILNRLDRLTAANYGMPINTNLCVNKFIKHKDKTIMLQATSIYTQGKGEKWDNKEMFDIML 256 Riemerell...
wustl:BD3180       177 ETIKVTRPDGRVVTLEYNSGMLNRLDRLTAANYGMPINTNLCKNMFVKHKDKTIMLQATSIYTQGDGGSWNKSKMFDIML 256 Parabacte...
jgi:Syn6312_0850   176 ETVQVFKPDGSFVEIRHDSGAMNRIDRVTAANYCMKINCNYCKNFFIGHKNSSIMLQAASIYAR--CEPWKEDEMRKIMM 253 Synechoco...
CBL22353           176 QNVNVTRPDGRIVTLVYNDGTLNRIDRLTAANYGMPINTNLCENRFVKSNGANIMLQAASIYTKGDGEHWAENDMVEVML 255 Blautia o...
CDC41040           176 ENVTVKRPDGREVTLIYNDGTLNRLDRLTAANYGMPINTNLCENRFVKCSGATIMLQAASIYTKGEGGHWNDEDMIMVML 255 Clostridi...
HYCyano:ANA_C11060 257 EVSKSSLKALGSEIFNQ 273 Anabaena sp. 90
WP_004916653       257 TISKTSLKVLGSDLFNQ 273 Riemerella anatipestifer
wustl:BD3180       257 EISKTSLQILGSDLFKQ 273 Parabacteroides distasonis ATCC 8503
jgi:Syn6312_0850   254 DIANTSIGIL------N 264 Synechococcus sp. PCC 6312
CBL22353           256 DVARTSLKMLGKDLFNQ 272 Blautia obeum A2-162
CDC41040           256 EVARTSLKMLGSDLFSQ 272 Clostridium sp. CAG:352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap