1QCK


Conserved Protein Domain Family
BAF

?
pfam02961: BAF 
Barrier to autointegration factor
The BAF protein has a SAM-domain-like bundle of orthogonally packed alpha-hairpins - one classic and one pseudo helix-hairpin-helix motif. The protein is involved in the prevention of retroviral DNA integration.
Statistics
?
PSSM-Id: 397214
Aligned: 49 rows
Threshold Bit Score: 122.675
Threshold Setting Gi: 326437153
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1QCK_A         1 MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTC-GANAKQSRDCFG 79 
EGD82723       4 rTTSKKHDEFVRERMEDKAATELAGIGEKGGEQLAALGFATAKQVLGQFLVMGEDPDVFGDWLQQNVsKLNSKHRGDLIF 83  Salpingoeca ros...
KRY41479       2 SSTSVKHREFVSEPIGEKEVTAIAGIGPVYGQKLIDKGFDKAYTILGQYLLLKRDNELFVEWLTDLI-GMSSKHAQSCYE 80  Trichinella spi...
NP_499085      1 MSTSVKHREFVGEPMGDKEVTCIAGIGPTYGTKLTDAGFDKAYVLFGQYLLLKKDEDLFIEWLKETA-GVTANHAKTAFN 79  Caenorhabditis ...
XP_008107188  31 VMRSQKCQNFVSEPMGNKPITAVDGIDEELGAKLAAKGFDKAYILLGQFLLLKKECAAFQNWLKSSF-DASSSEAEQSAL 109 green anole
XP_003476566   2 EPVSPRLRAFLSEPMGEKDVCWVDGIGRELAINLVTKGFSKAYILLGQFLLMHKDEDEFQKWLICCF-GATQCEAQRSAT 80  domestic guinea...
XP_017197275   2 AHMSPKLRAFLSEPIGEKDVGCIDGISRELAINLVAKGFSKAYILLGQFLLMHKNETEFQNWIICCC-GATECEAKRSSK 80  rabbit
XP_007959010   9 DHMSPRLRAFLSEPIGEKDVCWVDGISHELAINLVTKGINKAYILLGQFLLMHKNEAEFQRWLICCC-GATECEAQQSSN 87  green monkey
Q32PE7         2 DHMSPRLRAFLSEPIGEKDVAWVDGISHELAINLVTKGFNKAYVLLGQFLLMHKREAEFQKWLICCC-GATEFEARECSN 80  cattle
XP_001382109   3 nfMSCKLRTFLGEPMGEKCVAFVDGVGRDLARSLITCGYDKAYVLLGQFLLMHKKEEEFQMWLRMSF-GATRQEAHMIAN 81  gray short-tail...
1QCK_A        80 CLREWCD 86 
EGD82723      84 CLQEWIK 90  Salpingoeca rosetta
KRY41479      81 CIHDWSE 87  Trichinella spiralis
NP_499085     80 CLNEWAD 86  Caenorhabditis elegans
XP_008107188 110 CLLEWCY 116 green anole
XP_003476566  81 CLKEWCT 87  domestic guinea pig
XP_017197275  81 CLKEWCT 87  rabbit
XP_007959010  88 CLKEWCA 94  green monkey
Q32PE7        81 CLKEWCS 87  cattle
XP_001382109  82 CLREWCN 88  gray short-tailed opossum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap