2D9B,2D99


Conserved Protein Domain Family
GTF2I

?
pfam02946: GTF2I 
GTF2I-like repeat
This region of sequence similarity is found up to six times in a variety of proteins including GTF2I. It has been suggested that this may be a DNA binding domain.
Statistics
?
PSSM-Id: 397206
Aligned: 32 rows
Threshold Bit Score: 99.2111
Threshold Setting Gi: 1567491198
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2D9B_A         18 LRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKR 92   human
XP_030143704  751 LRTEVEELFEKKYAEAVKANGPVSIPYTSFLSHPEDLYVEGLPDGIPFRRPATYGIPRLERILLAKDRIQFVIKk 825  zebra finch
XP_016158364  766 LRTEVEQVFAEKYAEAIKAEGPVTIPYGLFQSHSEDLYVEGLPEGIPFRRPTTYGIPRLERILLARDQIQFVIKK 840  collared flycatcher
XP_016158364  978 LRNDVEDLFSKKFGEALGLSESVKVPYSVFESNPDALVVEGLPEGVPFRSPTWFGIPRLERITRASQKIKFVIKK 1052 collared flycatcher
TNM84507        5 lRRQVENLFSIKFAEALGLPEPAKVPYSKFQIYPEDLVVTGLPDGISLRRPNCYGTAKLRKILAASSQIQFVIKR 79   Takifugu bimaculatus
XP_011482272  594 LRRQVESLFGIKYAEALGLTEVTKVPYSRFQMYPEDLYVTGLPDGISLRRPNCFGAAKLRKILAASGQIQFVIKR 668  Japanese medaka
XP_015222792  578 LRKQVESLFNAKYGEALGLSQPTRVPYSKFQMYPEDLYVTGLPEGMSFRRPNCFGAAKLRKILAVSSNIGFVIKR 652  spotted gar
XP_002932338  559 LRKRVENLFNRKYAKAIGASGPVKVPYAKFLMYPEDLFVLGLPEGVSFRRPNCFGITKLRRILECSNGIQFVVKR 633  tropical clawed frog
XP_014343185 1624 LRKQVEALYNAKYAEAMGLSEPVKVPYPKFQMYPQDLYMEGLPAGISLRRPSCLGITKLQQILEASNAIQFVIKR 1698 coelacanth
XP_016158364  873 LRKTVDQLFCKSYGKALGSSEPKAVPYKIFEAHPTDLYVEGLPEKVAFRSPSWYGVTCLEKIIEAGNRIKFVIKR 947  collared flycatcher
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap