5Z62


Conserved Protein Domain Family
COX6C

?
pfam02937: COX6C 
Cytochrome c oxidase subunit VIc
Cytochrome c oxidase, a 13 sub-unit complex, EC:1.9.3.1 is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit VIc.
Statistics
?
PSSM-Id: 397198
Aligned: 45 rows
Threshold Bit Score: 71.0965
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5Z62_I                3 VLPKPR-MRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQ 70 
XP_006557545          5 KLPKPQ-LRDLHLSRVRRTLGIAALLCTFTGMSWKILVTDRYERKAEEFYKTYDPMKSLQIMNEAGLME 72  honey bee
XP_012062304          5 CLAKPR-LRNFLTAQIKRNLVLMMTISITGAMAVKILIADKRKRRYAEFYKTYDAEKQLKIMNEAGLMQ 72  Atta cephalotes
EFN61717              4 QLAKPK-LRALYAAQLKRNIIASITAGVIIAGLFKVFVCDKRKQKYVDFYKTYDPEKQLKIMNEAGLMQ 71  Florida carpenter ant
XP_015783744         28 RLEKPP-LRGQHRYILQNVLLLAFAVSFASGYALNTFFWIPRKERMNKFFDTYDDEKRTEELLAGGILd 95  two-spotted spider ...
7_pfamImport          1 -LPKPDgMKGALLKSVRAGVFPAVAVCLGVYGAVLYATFFRRKAKIDTYMKNLDPDALFEELKEYGVFK 68 
WGS:AAPP:GF14300-PA   7 peisFP-IHNSHFNKTMANVKVACVLALTAPLLLYAFRNVPHKRKYKYFYSHYDPLDAFDRMMNGGYLE 74  Drosophila ananassae
XP_002065376         11 pqFKFP-MHDIHLKKSLGNLKVACILALAAPMCFYVFHNLPRKMKYKNFYSNYDPMDAFDRMMNGGYLS 78  Drosophila willistoni
Q8T970                4 EKFKFP-MHDLHLKQTFRNVKMACTLALLAPLLFYTLHNNPRKRKYRNFYSTYDPMDAFDRMMSGGYLS 71  fruit fly
EDW02858             11 pKFKFP-MRDIHLNKSLRILKTACILSLVAPFCLYMLSNAPRKLKYKNFYANYDPMDAFDRMQSGGYLA 78  Drosophila grimshawi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap