1OIS


Conserved Protein Domain Family
Topoisom_I_N

?
pfam02919: Topoisom_I_N 
Click on image for an interactive view with Cn3D
Eukaryotic DNA topoisomerase I, DNA binding fragment
Topoisomerase I promotes the relaxation of DNA superhelical tension by introducing a transient single-stranded break in duplex DNA and are vital for the processes of replication, transcription, and recombination. This family may be more than one structural domain.
Statistics
?
PSSM-Id: 397183
Aligned: 126 rows
Threshold Bit Score: 264.34
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OIS_A                4 KWVTLKHNGVIFPPPYQPLPSHIKLYYDGKPVDLPPQAEEVAGFFAALLESDHAKNPVFQKNFFNDFLQVL--KESGgpl 81  baker's ...
EGD78186            248 YWRTLEHRGPMFAPPYQPLPKDVYLLYDGKPYHFEPAAEEVATFYAAMLERDYVKKPVFNKNFFADWKTTMtaQEKKd-- 325 Salpingo...
2_pfamImport          2 KWKFLEHNGPYFPPDYQPLPDNVHFFYDGMEVKLSPAAEEVAVFFGRMLDHEYTFEEVFQANFLTDWRKEMvdEERLl-- 79 
Q9WUL0              218 KWKFLEHKGPVFAPPYEPLPEGVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMtnDEKNt-- 295 Norway rat
AAI21626            132 KWKFLEHEGPVFAPPYEPLPDSVKFYYDGKPLPLSLQAEEVASFFAKMLDHEYTTKEIFRNNYFMDWRKEMtlEERMv-- 209 tropical...
XP_022529630         48 KWSTLEHNGPLFPPEYEPLPSNVPFLYDGEPVKLSLATEEVATFYAKMLDHEYTTKEIFQNNFFTDWREVMteSERRl-- 125 Mexican ...
XP_006634230        362 KWQFLEHKGPLFASEYEPLPENVKFYYSGKPVKLSLTAEEVAVFYAKMLDHEYTTKEVFQKNFFHDWKQEMtaEEQSl-- 439 spotted gar
WGS:AANI:GJ16237-PA  67 KWQTLEHNGPLFPGAYERLPENVHFLYDNCPIELTEQAEEVATFYAKVLGTPFVELSEFNENFFKDFRSCLsvEQRLh-- 144 Drosophi...
XP_002003060         64 KWQTLRHNGPCFPADHERLPADVKFYYDNCPVELTEQAEEVATFYAKLMKTAFVQMREFNQNFFNEFRSCLseEQRRy-- 141 Drosophi...
XP_015223684         95 KWKFLEHRGPWFPAEYQRLPDNVKFYYDGKLVTLSSAAEEVAVFFAQMLDHEYTTKEVFRNNFFSDWRKEMtlEEKMi-- 172 spotted gar
1OIS_A               82 ngieIKEFSRCDFTKMFDYFQLQKEQKKQLTSQEKKQIRLEREKFEEDYKFCELDGRREQVGNFKVEPPDLFRGR-GAHP 160 baker's ...
EGD78186            326 ----IKDLKKCDFSLIHRFLKQRAEERKGASKEEKQKRKEENDKIKQEYGFAIIDGRRAPVGNFKIEPPGLFQGR-GEHP 400 Salpingo...
2_pfamImport         80 ----ITDLDKCDFREIHTMHKATVEAKKNSTVAEKLALKEANQKILEEYGYCLLDHHKERIGNFKIEPPGLFRGR-GGHP 154
Q9WUL0              296 ----ITNLSKCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEYGFCVMDNHRERIANFKIEPPGLFRGR-GNHP 370 Norway rat
AAI21626            210 ----ITDLAKCDFTEMFTYYKGKMEEKKNKSKEDKLKIKEENEKLLQEYGYCSMDHHRERIGNFKIEPPALFRGR-GDHP 284 tropical...
XP_022529630        126 ----IKKLSKCDFSSIHKYFVEKAEEKKNMTKEEKQVLKDEANKLTEHYGYCLLDGHKEKIGNFRVEPPGLFRGR-GEHP 200 Mexican ...
XP_006634230        440 ----IKDLSKCDFKEIHQYFEKKTEEKKAMTKEGKQALKKAAEMVTEEYGYCLLDGHREKIGNFKIEPPGLFRGR-GDHP 514 spotted gar
WGS:AANI:GJ16237-PA 145 ----FTSFDLCNFQKIHQYLEEQQEARS-----------QQELEEDERYGYCYIDGERHRINQFRIKPPGLCCPRkGYSL 209 Drosophi...
XP_002003060        142 ----ITCFELCNFCDISQYLECQREDE-----------KERIAEENKLYGYCLVDGESRRITQFRISRPGLCCPRhGFST 206 Drosophi...
XP_015223684        173 ----ITDLNKCDFSEIYKMHKEKVEARKNQGKEEKQKTKDANQKLLEEYGYCTLDHHRERIGNFKIEPPGLFRGR-GDHP 247 spotted gar
1OIS_A              161 KTGKLKRRVNPEDIVLNLSKDAPVPPAPEGHKWGEIRHDNTVQWLAMWRENIFNSFKYVRL 221 baker's yeast
EGD78186            401 KMGKLKRRVLPEQVIINIGKEAKVPEPPAGHRWKEVRHDNKVSWLAAWVENIQKSNKYVML 461 Salpingoeca rosetta
2_pfamImport        155 KKGMLKKRIQPEDVTINCSSESRVPVPPAGHSWKQVRHDNTVTWLASWTENIQGVTKYIML 215
Q9WUL0              371 KMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIML 431 Norway rat
AAI21626            285 KQGMLKKRILPEDIIINCSKDSKIPEPPPGHKWKEVRHDNTVTWLASWTENVQGSVKYIML 345 tropical clawed frog
XP_022529630        201 KMGKLKKRVQPEDVIINCSQDAKIPDPPVGHRWKRVQHDNSVTWLASWVENIHAHIKYIML 261 Mexican tetra
XP_006634230        515 KMGKLKRRIQPEDVIINCSKESKIPVPPQGHKWKKVQHDNTVTWLASWVENVQGGIKYIML 575 spotted gar
WGS:AANI:GJ16237-PA 210 TMGMIRPRVLPEDIMINCDEYAEPPAPPPGHRWRQVVHDRSVSWLYSWHDLVSGNTYYVRa 270 Drosophila virilis
XP_002003060        207 TMGTIRPRVLPEDVVINCDENEEPPAPPCGHLWAAVVHDRTVRWVYAWNDIVTGcmhhayp 267 Drosophila mojavensis
XP_015223684        248 KQGMLKKRIQPEDVIINCSKDSKIPQPPLGHQWKEVRCDNTVTWLASWTENVQGLCKYVML 308 spotted gar
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap