3BQY,2OPT


Conserved Protein Domain Family
TetR_C

?
pfam02909: TetR_C 
Click on image for an interactive view with Cn3D
Tetracyclin repressor, C-terminal all-alpha domain
Statistics
?
PSSM-Id: 397174
Aligned: 11 rows
Threshold Bit Score: 115.191
Threshold Setting Gi: 165761351
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BQY_A               65 AG-ATGDgDWSERTARLARALRAALLAHRDGARVFAGTHATGPNTLRFADGLVGVLREAGFGDGDAARALYSVANFTVGH 143 Streptom...
BAC70092             73 EP-QEPTgDLRADLTTLARRRRQILLRHLWLAPLLATRPIMGPNFMRGMERDLAVLAGCGLGMDDTIHVLNLIHSWVSGA 151 Streptom...
Q9EWD6               72 TP-LDPAdTWRERLLTANRGLRAALLAYRDGAKVFSGSRFTGAVHAEYMEGTLRLFTAAGLTLAQAVRATTTTYLFTLGF 150 Streptom...
wkYale:SALWKB2_0696  68 TP-RDDD-DWRSFLKGNACSFRRALLAYRDGARIHAGT-RPAAPQMEKADAQLRFLCDAGFSAGDATYALMAISYFTVGA 144 Snodgras...
Q7CUB2              113 LP-KPGQ-DWITFTLANARSIRKTLLTVRDGARLTAGT-RPSVAEFADVESVLQLYVETGFSAEEAFGIAICITRYVVGY 189 Agrobact...
WP_000113282         68 LP-AAGE-SWQSFLRNNAMSFRRALLRYRDGAKVHLGT-RPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGA 144 Proteoba...
WP_006248868         68 LP-LPNE-TWQDFLRNNAKSFRQALLMYRDGGKIHAGT-RPSESQFETSEQQLQFLCDAGFSLSQAVYALSSIAHFTLGS 144 Proteoba...
Q9F2Y9               96 NPaDLGDgGWRAALEGLGHATLALYRRHTWLLEVNQSRPVLGPSALDGMERVLARIKPMGLTDPELVSVIVMIDGYVVGA 175 Streptom...
Q9RZ11               74 LP-DLNEgSWQERFSRLAHSLRRSMVRHASFIGYYFRGHRVSREELDVYESLYRLLRQVGLPEEVITKYGSVLVIFMVGF 152 Deinococ...
Q9CFG3               66 FP-ANEK-TWQDRLFVYGKNIYTVLESYPNLAQLMMDYPPESENYLRLFDKLLMIVDDLKLSDDHKFYTINLFLNFIYTS 143 Lactococ...
2OPT_A               69 eP-EPGR--WAEQVKEMCRSLRRMFLAHRDLARIAIDRVPLGPNGMVGMERTMNLLRSGGLHDELAAYGGDLLSTFVTAE 145 Streptom...
3BQY_A              144 T--------LEEQAALTPGGGGPLDEAT-LREAVAAG--TYPH--LAATLP---VLTSTDFTAHFEFGLRLLLDGLRAV 206 Streptomy...
BAC70092            152 VqaelteraTANQSGLDRHAWRLRMEPY-LKSLLETG--EFPH--LSRMVQ---TSEIGEADERFANGLAIILDGIEAR 222 Streptomy...
Q9EWD6              151 V--------TEEQGVEPLPGERREGFDV-EERARLLA--DYPL--TAAAG----AEIFTDYDRHFEESLALVIEGVAAT 212 Streptomy...
wkYale:SALWKB2_0696 145 V--------LEQQASEADAEERGEDQLT-TSASTMP-----AR--LQSAMK---IVYEGGPDAAFERGLALIIGGLERs 204 Snodgrass...
Q7CUB2              190 V--------LEEQG--ERERDRMDQHSPnTDIMAELA--QFPL--LAKALEsfpTVGTVNTEAVFESGLSYLLAGMKEK 254 Agrobacte...
WP_000113282        145 V--------LEQQE--HTAALTDRPAAP-DENL--P-----PL--LREALQ---IMDSDDGEQAFLHGLESLIRGFEVQ 200 Proteobac...
WP_006248868        145 V--------LETQE--HQESQKEREKVE-TDTVAYP-----PL--LTQAVA---IMDSDNGDAAFLFVLDVMISGLETV 202 Proteobac...
Q9F2Y9              176 ArtqvyereAERRSGLTDAQFWAAQGPV-LVEAMSSG--RYPV--LSSLSEdafGTGF----DHFEFGLQRILDGLEVL 245 Streptomy...
Q9RZ11              153 C--------YAELNGNFAPSAFAQRRAF-AERQPER---------FPLALSlpmPAASENEDDFFEVALELMLAGIKTQ 213 Deinococc...
Q9CFG3              144 K--------IDSDRLVEQHEKPLSTVKI-PLVQLAP---------FLDKYWrteSLTSLGSSESFEFGLQLIISGIEKM 204 Lactococc...
2OPT_A              146 A--------LEQSSRNPGTEQGREQAGV-FADQLHGYlkSLPAtsFPNLVHlagPITSLDSDRRFELGLEIIIAGLLAg 215 Streptomy...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap