1NS3


Conserved Protein Domain Family
Peptidase_S29

?
pfam02907: Peptidase_S29 
Hepatitis C virus NS3 protease
Hepatitis C virus NS3 protein is a serine protease which has a trypsin-like fold. The non-structural (NS) protein NS3 is one of the NS proteins involved in replication of the HCV genome. NS2-3 proteinase, a zinc-dependent enzyme, performs a single proteolytic cut to release the N-terminus of NS3. The action of NS3 proteinase (NS3P), which resides in the N-terminal one-third of the NS3 protein, then yields all remaining non-structural proteins. The C-terminal two-thirds of the NS3 protein contain a helicase. The functional relationship between the proteinase and helicase domains is unknown. NS3 has a structural zinc-binding site and requires cofactor NS4A.
Statistics
?
PSSM-Id: 397173
Aligned: 10 rows
Threshold Bit Score: 235.016
Threshold Setting Gi: 68565638
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NS3_A   30 EGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTR 109 
Q9QIX6 1056 EGEVQVVSTATQSFLATCINGVCWTVFHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSMTPCTCGSSDLYLVTR 1135 Hepacivirus C
O39928 1057 EGEVQFLSTATQTFLGICINGVMWTLFHGAGSKTLAGPKGPVVQMYTNVDKDLVGWPSPPGKGSLTRCTCGSADLYLVTR 1136 Hepatitis C virus (...
Q69422  970 TGTIFRLGSLATSYMGFVCDNVLYTAHHGSKGRRLAHPTGSIHPITVDAANDQDIYQPPCGAGSLTRCSCGETKGYLVTR 1049 Hepatitis GB virus B
Q9WM98  923 pGNVMVLGTATSRSMGTCLNGLLFTTFHGASSRTIATPVGALNPRWWSASDDVTVYPLPDGATSLTPCTFQAESCWVIRS 1002 GB virus C
O56074 1007 EGSIVVLGTSTTRSMGTCVNGVMYTTFHGSNARTLAGPVGPVNCRWWSPSDDVAVYPLPSGASCLEPCKCGTQSVWCIRN 1086 Pegivirus A
Q96898  992 HGNVVVLGTSTTRSMGCCVNGVVYTTYHGTNARPMAGPFGPVNARWWSASDDVTVYPLPNGASCLQACKCQPTGVWVIRN 1071 Pegivirus A
Q9Q9A7 1060 AGEIQVLSTVTQSFLGTSISGVLWTVYHGAGNKTLAGSRGPVTQMYSSAEGDLVGWPSPPGTKSLEPCTCGAVDLYLVTR 1139 Hepacivirus C
Q81258 1062 TGEVQVLSTATQTFLGTTVGGVIWTVYHGAGSRTLAGAKHPALQMYTNVDQDLVGWPAPPGAKSLEPCACGSSDLYLVTR 1141 Hepatitis C virus (...
Q68798 1060 AGEIQILSTATQTFLATCVNGVCWTVYHGAGSKTLAGPRGPVCQMYTNVDQDMVGWPAPAGTRSYTPCTCGASDLYLITR 1139 Hepatitis C virus (...
1NS3_A  110 HADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFV-PVESMETT 178 
Q9QIX6 1136 HADVIPVRRRGDGRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFI-PVESMETT 1204 Hepacivirus C
O39928 1137 HADVIPARRRGDTRASLLSPRPISYLKGSSGGPIMCPSGHVVGVFRAAVCTRGVAKALEFV-PVENLETT 1205 Hepatitis C virus (isolate EU...
Q69422 1050 LGSLVEVNKSDDPYWCVCGALPMAVAKGSSGAPILCSSGHVIGMFTAARNSGGSVSQIRVR-PLVCAGYH 1118 Hepatitis GB virus B
Q9WM98 1003 DGALCHGLIKGD-KVELEEAMEVSEFRGSSGSPVLCDEGHAVGMLVSVLHSGGRVTAARFTrPWTQVPTD 1071 GB virus C
O56074 1087 DGALCHGR-LSK-LVELDLPTEISDFRGSSGSPILCDEGHVVGMMVSVLHRGVKVTGVRYVkPWETLPKD 1154 Pegivirus A
Q96898 1072 DGALCHGT-LGK-VVDLDMPAELSDFRGSSGSPILCDEGHAVGMLISVLHRGSRVSSVRYTkPWETLPRE 1139 Pegivirus A
Q9Q9A7 1140 NADVIPARRRGDKRGALLSPRPLSTLKGSSGGPVLCPRGHAVGIFRAAVCSRGVAKSIDFI-PVEALDVV 1208 Hepacivirus C
Q81258 1142 DADVIPARRRGDSTASLLSPRPLACLKGSSGGPVMCPSGHVAGIFRAAVCTRGVAKSLQFI-PVETLSTQ 1210 Hepatitis C virus (isolate NZL1)
Q68798 1140 QADVIPARRRGDNRAGLISPRPISTLKGSSGGPLLCPSGHVVGLFRAAVCTRGVAKALDFV-PCEAMDAT 1208 Hepatitis C virus (isolate JK...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap