6NPM


Conserved Protein Domain Family
EBV-NA1

?
pfam02905: EBV-NA1 
Click on image for an interactive view with Cn3D
Epstein Barr virus nuclear antigen-1, DNA-binding domain
This domain has a ferredoxin-like fold.
Statistics
?
PSSM-Id: 397171
Aligned: 2 rows
Threshold Bit Score: 251.851
Threshold Setting Gi: 123863003
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6NPM_B   2 HMGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGP 81  Epstein-Barr virus (s...
Q1HVF7 468 HRGEGGSSQKFENIAEGLRLLLARCHVERTTEDGNWVAGVFVYGGSKTSLYNLRRGIGLAIPQCRLTPLSRLPFGMAPGP 547 Epstein-barr virus st...
6NPM_B  82 GPQPGPLRESIVCYFMVFLQTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDL 140 Epstein-Barr virus (strain B95-8)
Q1HVF7 548 GPQPGPLRESIVCYFIVFLQTHIFAEGLKDAIKDLVLPKPAPTCNIKVTVCSFDDGVDL 606 Epstein-barr virus strain ag876
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap