1BVZ


Conserved Protein Domain Family
Alpha-amylase_N

?
pfam02903: Alpha-amylase_N 
Click on image for an interactive view with Cn3D
Alpha amylase, N-terminal ig-like domain
Statistics
?
PSSM-Id: 397170
Aligned: 35 rows
Threshold Bit Score: 84.2836
Threshold Setting Gi: 74506345
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BVZ_A                          1 MLLEAIFHEAKGSYAYPISETQLRVRLRAKKGDVV-RCEVLYADRYAS-PEEELAHALAGKAGSDERFDYFEALLECSTK 78  Thermoactinomyces vulgaris...
Q8DPX9                          9 MELSAIYHGPESEYAYLYKDKKLHIRIRTKKGDIE-SINLHYGDPFIFmEEFYQDTKEMVKITSGTLFDHWQVEVSVDFA 87  Streptococcus pneumoniae R6...
WP_012005490                    1 ML--NAWHQPVPPFVVK-KGQRLDITLWLQGDDVPeRVFLRAEPDNEE------WLLTMKVQHIDGLHRY-QASLTLNEG 70  Serratia proteamaculans...
CBN72339                        1 MKLEAIYHKPYSEFAFPVAPDTLVIRLRTAKNDVN-TCILIYHEKYDT---SQRGKVKMDKVASDGMFDYYEVELNVGIK 76  Hungateiclostridium thermocellum ATCC 27405...
Q2RHD3                          1 ML----HHRPGIRFCQPLAPDRLLLRLKIGRREQQ-SCQVIYEDRGLK-------TAPMHAYARTPRYLYYQAEISLSRP 68  Moorella thermoacetica ATCC 39073...
ABP66065                        1 MQ---VIHN-QVHDIFALSKNRFYVKLWVQRGFAK-NVTLIFSDRYDL----DVQKVKMDFYMNVGNFEVYTAQVQNKTP 71  Caldicellulosiruptor saccharolyticus DSM 8903...
hbprmlniaid:MGAS10270_Spy1122  10 ML-----HIPDSRYCFAISQKELVIRLRVAKEDRGiTVNLVHGPKYGY--HEFQEELEMSVAYTDHTHAYYETTLTLDDV 82  Streptococcus pyogenes MGAS10270...
Q5BLZ7                          1 MLIEALFHETRVPYACPENLHSLRVRLRAGKGEIA-RCLVLHADRYEL-LDSCFQQTEAEWMASDQRFDYFEALLECTAK 78  Laceyella sacchari...
P29964                          1 MIKEAIFHKSDVPYAYPLNENQLKIVLRTAVFDVD-RVYVLYKDRYDW--LGKFKIKPMVLTHTNELFDYYETTLELNKK 77  Thermoanaerobacter pseudethanolicus ATCC 33223...
WP_012636548                    1 MNRAAIYHVCGGSYAFPVNKNTLRIRLRAARNDLD-RVVVVYGTRYPGdGEDPYLSQEMELVACDELHDYYEADIRLDDA 79  Halothermothrix orenii...
1BVZ_A                         79 -R--VKYVFLLTGpQGEAVYFGETG---FSAERSKA---GVFQYAYIH 117 Thermoactinomyces vulgaris
Q8DPX9                         88 -R--IQYLFELRDtEGQNILYGDKGc-vENSLENLHaigNGFKLPYLH 131 Streptococcus pneumoniae R6
WP_012005490                   71 -EptRRYCFKLVW-AASQQWFGPQG---WSLTPPGQ-----LAQFAVD 108 Serratia proteamaculans
CBN72339                       77 -R--IKYMFYLED-NYSIKWYSSDG---FFDYMPQW---GHFTYSYIC 114 Hungateiclostridium thermocell...
Q2RHD3                         69 wR--CRYFFRLREgDGDDRYIFAGGt-------------GQQGRPFTY 101 Moorella thermoacetica ATCC 39073
ABP66065                       72 -R--FAYKFLIELlDGSFKVFNQFG----LLDTEENlyfDAFQFPYAN 112 Caldicellulosiruptor saccharol...
hbprmlniaid:MGAS10270_Spy1122  83 -R--LAYIFKIEE-EGQTYYFSEDGlttSYDFSNGFy--NFFQMPYIN 124 Streptococcus pyogenes MGAS10270
Q5BLZ7                         79 -R--LQYVFLLEGkKGERVYFGESG---VSKERNRA---GVFQYAYIH 117 Laceyella sacchari
P29964                         78 ----FVYFFYLVSdGGEKLYYTEAG---FYKKRPENhfwGFFHYPYIG 118 Thermoanaerobacter pseudethano...
WP_012636548                   80 -R--FRYHFYLED-VQESLWLNEKG---FFEERPRGffsGFFQYPLIN 120 Halothermothrix orenii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap