2F3O,1R8W,6ND3,2YAJ


Conserved Protein Domain Family
PFL-like

?
pfam02901: PFL-like 
Click on image for an interactive view with Cn3D
Pyruvate formate lyase-like
This family of enzymes includes pyruvate formate lyase, choline trimethylamine lyase, glycerol dehydratase, 4-hydroxyphenylacetate decarboxylase, and benzylsuccinate synthase.
Statistics
?
PSSM-Id: 397168
Aligned: 123 rows
Threshold Bit Score: 361.947
Threshold Setting Gi: 81505110
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F3O_B          2 CMD--RIEK----LIKKV----SKPArL-S---------VERCRLYTESMKQt-----EGE-PMI--IRQAKAlk----h 49   Archaeoglobus...
WP_006069341    1 MSS--KIENnpsqVDVNKkipcEKPAiM-Q---------LEIMEAYTRAHQS----------EENlyKREVACls----e 54   Vibrio medite...
WP_011966617    5 NVE--GAQN----VEISKklpcEKPLiV-Q---------LEIMERYTAVHKA------CAAlPKE--IREVEClk----v 56   Parabacteroid...
Q2HBR9        360 PSr--RLLSlmarTFSHWrdswMKKQvFpR---------LPHLSKLLSEDQKg----tLATiPIA--VRKGLAnqktlae 422  Chaetomium gl...
Q8XZ58        495 LRq--QLEH----FFADPshatERDAlL-AeaggdvkgpTPQARAADHVMRQ----------PVAlrAAWAARllcnlaa 557  Ralstonia sol...
EDO62661        3 LSE--RMER----LFSYAkstwKDPPpC-P---------FNRDFQYAAVNLF------SDK-EVW--ERAALSfa----y 53   [Clostridium]...
2YAJ_C         40 LM---DIYY----TLKVT---------A-D---------MEAAYWYNRTWWEn-----DGE-VIE--VRRAKAva----a 81   Clostridium s...
WP_005426151    1 MMagyRFNKee-yFKETKavysNYPTdV-S----------RMEKELDRLQKE---------------NPKASSfq----k 49   Blautia obeum
Q8A3J9          4 YEq--KIAN----LRMRKlaqtQEKI---EkeglldeddYGRVVPPENLWNIipn-hpDGSfYGF--DAWADNfc----s 67   Bacteroides t...
EDO60733       16 YDd--RIRI----LKQRKleetQAKS---KmkvyqdgddYGSIPAPENYQFHcipnheNGSwYGY--DGWSKNfh----k 80   [Clostridium]...
2F3O_B         50 VLENI---------PIQILDSELIVGTM-LPNPPGAIIF--PEGVGLR-------IINE-LDSlpnr------------- 96   Archaeoglobus...
WP_006069341   55 LYPVL---------FRQIESEDIVVGRL-DALPIGFGSV----------------TSVGgVGHycnf------------- 95   Vibrio medite...
WP_011966617   57 LYPTL---------FRKITNQDLIAGRT-DFLPIGFGCV----------------TSLGgVGHycvf------------- 97   Parabacteroid...
Q2HBR9        423 LLSNPrsqiaqengLLRIEAKELIVGVI-------------PDFT----------LGRGkEVV----------------- 462  Chaetomium gl...
Q8XZ58        558 RLDGVgrrgnggmdTCDIHPLDLLAGSM-------------PAQS----------LAEGrYVI----------------- 597  Ralstonia sol...
EDO62661       54 ALRRA---------PVIITDDDRIIGRAyQVRFAEPDCYd-PE------------LKDYsLQS----------------- 94   [Clostridium]...
2YAJ_C         82 SLSHM---------TPTILPYEKLVMNK-TKNVRGAFPF--PWVCASFfnaqaeaLMNE-VDApaeneadsvsvvgaggg 148  Clostridium s...
WP_005426151   50 KTWIY---------RTAARDAEVILFPS-------SPFY--AEIDTGR-------EQNS-VTAsfpp------------- 90   Blautia obeum
Q8A3J9         68 LMNIH---------PVYIDADDAFAGRWmYFMSKMRPNKwnPDYSyd--------------------------------- 105  Bacteroides t...
EDO60733       81 LMSEH---------PVYIDPVDAFSCRWmFSMIWFEEKS--PEKGLHW-------------------------------- 117  [Clostridium]...
2F3O_B         97 -----------etnRLMV-DEEDAKVLREeia--pywQRKTIEAFAFPLMPDIM-------QILYTGSVFV--LTEIAGI 153  Archaeoglobus...
WP_006069341   96 ----------dkleAFKTeLSPEEHSRVDvll--dywKERDTRSIYFRQTLTEAtlgkfvdVNy--------pAIATARL 155  Vibrio medite...
WP_011966617   98 ----------kklrAFQLqLDETERKRVDaly--dywLDHDLKTQFNKEVLTEDtlgmfidCEy--------pMIATARL 157  Parabacteroid...
Q2HBR9        463 --------------PYLS-DEETMAAWLKg------------------------------------------sLNEWSAM 485  Chaetomium gl...
Q8XZ58        598 --------------DYTRdDDDEAERFRWfn----------------------------------------lsLSPTSGV 623  Ralstonia sol...
EDO62661       95 -------------------------------------PGFESGEAVYKGYTD-----------LAELHLVT-----EPAR 121  [Clostridium]...
2YAJ_C        149 nvtesygnvisiakKFGM-RKEEIPVLVKtsk---pwEGISVEELSNKY--SKMtpgydqfKNIMESVICMfdS-FAIPQ 221  Clostridium s...
WP_005426151   91 ---------------qpgiGCWLMKQYPDfvdgygewSGYYGKYGVm-------------------------nGPQFMDA 130  Blautia obeum
Q8A3J9        106 -----------------------------------flKENIKKYDLICGIGDDA-------------------------- 124  Bacteroides t...
EDO60733      118 -------------------NPNFSyd---------ylKPEQELYGIISGIGSDA-------------------------- 143  [Clostridium]...
2F3O_B        154 SHVAVNYPYLLRRGFRWFLEESERRIRALEesgvyegekys----fyqaakivseaVINYGLRYSKLAEELAESe---dG 226  Archaeoglobus...
WP_006069341  156 SGMYLDYNKLIDNGIGGMRRLIGDKLDSArachdtkaial------hesflgcfdiVEKVIDHHIKLCAKELEVtt--dL 227  Vibrio medite...
WP_011966617  158 SGMMLDYPKLLDKGIGGLRSDLQEKLKEQpdnnfyka------------giqcldiFVDCASHLQQDAREQMASa---nM 222  Parabacteroid...
Q2HBR9        486 GHIVPGYDLLVRDGLKKMITDIKDKLAKVSdpasatasfy-------esciislegVQGYLRNWAKIAQRAAIAagmtaP 558  Chaetomium gl...
Q8XZ58        624 GHVVPGYEALLTHGIRGVSRQIDEAQQALAatdpqraeavap---fyagsrlalrgLAEYLEGLAGTAHDTAQAlpqdqK 700  Ralstonia sol...
EDO62661      122 GHITWDWTKILRLGTEGLKAQYENALhsakdleaehf---------yrgvlialeaLEDWNDQHVAYLRKMGKQ------ 186  [Clostridium]...
2YAJ_C        222 GREVINYYMPLQYGFDGIIKLCDEKIAEVMgeagddgdfgmsrgyyyaamkeitkgLSAWCENYSKRAKYLASIet--dS 299  Clostridium s...
WP_005426151  131 AHHYANCETILKYGLSGIIRHARMRLEEKDltdhqqdfl--------kcmidvcrsLQRISERFAEKAEEMLKTeh--dE 200  Blautia obeum
Q8A3J9        125 -HFAPDYEIGVKLGWNGLIKKIEHYQSMHHseeqqhfys---------lhlrvirsVQGWIQRHIDQAYRMAASat--dD 192  Bacteroides t...
EDO60733      144 -HFGGDYQLGLSLGWGGLLEKLAFYRKKHPehaefyda-----------eelvirgIQNWISRAIAEGERMAEAer--hP 209  [Clostridium]...
2F3O_B        227 ERREELLKIAEICRKVPAEK-PETFWEAVQFVWLV-QSALHQENYE-QAISMGRIDQYLYPFFKKDIGEGRINRELAFDI 303  Archaeoglobus...
WP_006069341  228 TRKHQMNDLIDALNAIRNDK-PQTFLQGIQLSWLY-SLCS-------GVVNFGRMDDYLGDLLVADLETGRITERQAINY 298  Vibrio medite...
WP_011966617  223 KRQKELERICQALENIKEKK-PGTFHEAMQLFWLF-ALLA-------GVINYGRLDDYLGPYLVADLKSGRLTDEEAYRY 293  Parabacteroid...
Q2HBR9        559 DDVANMKDVEARMNRLADDA-PESFQDAVQLIYSF-HCCLHLVGEL---TPFGRLDQILYPYLSK---GGGTTLEHAQEI 630  Chaetomium gl...
Q8XZ58        701 IERTNLAEMEARLRRLASGAvPETVLDALQLVLAC-HATLHLCGEP---VAVGRLDRLIRPFQEKAP----LGETQLQEA 772  Ralstonia sol...
EDO62661      187 -------ELADLCQHVPRHP-ARGFKEAIQSFFMQ-YLAVFYENPF-GGNGPGQFDKYLWPYLKKDLENGSCTLEEAEEL 256  [Clostridium]...
2YAJ_C        300 EIKANYEKIEEVMGNIAHKK-PANFWEAIQMTLCC-HFGVVNEDPQ-SGLSIGRLGQVLQPFYEKDVEDGIMTDEEVIEL 376  Clostridium s...
WP_005426151  201 EHVKALKMIAVTARRIPSEP-AETFYEAMCAIWFTrEMCNALDGLGfAVI--GHLDRILISYYERDLKNNRITPDEAQEL 277  Blautia obeum
Q8A3J9        193 CSKNNLLEIAKVNESIINDA-PTTLREACQWIIWY-HLASRTYN---RDGAGGQIDTLLAPFYEKDLAEGRIDKETAVYY 267  Bacteroides t...
EDO60733      210 VLKENLRQMARVNRNILNGA-PKTMREACQWVCWF-NMASRTYN---RDGAGFQLDEVLKRYYDADLEAGRITRDEAVFY 284  [Clostridium]...
2F3O_B        304 LANLWIKTNEIVPAFDSLLEQ-----------------YFSGqAT-NQAVTIGGCD----IYGNDATNELTYLMLEVTDR 361  Archaeoglobus...
WP_006069341  299 IRSHYRLIEARKTTV-------------------------------NGRVVVGGLG----RRNPETADVYCKLAIQAVRE 343  Vibrio medite...
WP_011966617  294 IHSLWTMIENRRTTV-------------------------------NGRIIVGGKG----RKHPKEADVFLHIAMKVAKN 338  Parabacteroid...
Q2HBR9        631 IDCLWVKIGENAFVNRAFIYDyvtygttavcglggnfpQGGGiNQwVQQITVGGYKatdsATPECGANAVTMLCLKAARR 710  Chaetomium gl...
Q8XZ58        773 IDCFWLKLGEKTLLNRIFIDDrqelgnlamgnragpypKGQSvNQwIQQVTVGGLN----ADGSWEYSDVTLACLRASSR 848  Ralstonia sol...
EDO62661      257 VEELFIRLDERVSANDLW----------------------------NEMIITGGTH----RDGSSAVSPLSKIMVDAIMK 304  [Clostridium]...
2YAJ_C        377 LELYRIKITCIECFASAGVSG-----------------GVLSgNT-FNNLSLGGQN----YDGLSAVTPLEYLIVEAGMR 434  Clostridium s...
WP_005426151  278 IDCFVSMTDARWNLEAD---------------------LPGGtNA---DIIIGGCD----KNGDIVYNDISRMIINSYKK 329  Blautia obeum
Q8A3J9        268 LACFLLNDPVYWQ--------------------------------------LGGPD----ESGKDQTSPLSFLILEAADK 305  Bacteroides t...
EDO60733      285 IACLLLNDPHYYQ--------------------------------------IGGTD----ENGEPLLSEFSYMVLEGADK 322  [Clostridium]...
2F3O_B        362 LRLRQPNVHVRINKGSP----ESFLKRLAEAISSg-CNNLALFFDDAAVKalk------------------naeVDdRDa 418  Archaeoglobus...
WP_006069341  344 NKDTEPQFTLRIYKGMN----QGVYQDALEAIGEg-LTYPILYNDDVNVPavmn-----------------smqISeQDa 401  Vibrio medite...
WP_011966617  339 CRYVEPQFTLRFDKETS----EEIWDEALDALGAg-ATYPTLYNDDVNVPavmy-----------------gmrVDeKTa 396  Parabacteroid...
Q2HBR9        711 IPVNAPTLSLRVHKDIP----HEYLDEAAKGILSg-GAQPILYNDDKLCPalkds--------------atanvVDlKWs 771  Chaetomium gl...
Q8XZ58        849 LPFNAPVLSLRVSRDMPsawrKRLLAEAARGQLSg-GASPILLNDDKIIPalsssgiaigprasadeaarwnaaVRrEDa 927  Ralstonia sol...
EDO62661      305 LNITHPTVYMRVPKDAD----EEYVKLCAKYLKYg-NNRAQIYYDPNVIRalte-----------------tdgVRpEDa 362  [Clostridium]...
2YAJ_C        435 NQTPQPTLSVLYDEKTP----EDFLMKAASCTKLg-LGYPAWMNNQTGMNfmmrn--------------ygpegMDlHDa 495  Clostridium s...
WP_005426151  330 YHFANPKLQVRISAKHP----DEFLLQVGELAGMg-LNVLSIFNDDVIIPanq------------------kqgKSlEDc 386  Blautia obeum
Q8A3J9        306 I-NTSLNLTVRVFDGLN----KDLFRKSVEYLVKnkNGWPRFSGDKALVEgfm------------------kngFSaQLa 362  Bacteroides t...
EDO60733      323 L-DSACNITVRVDKNID----RKFLHKAVDYLFKnkNGWPRFSGDEALNRgfm------------------rlgYPeSLa 379  [Clostridium]...
2F3O_B        419 lNYTTDGCVEI--A-------------PFGNSFTSSd--AALINV--AKALEYALNEGvdLQFGYEFG-----A--KT-E 471  Archaeoglobus...
WP_006069341  402 qHYVPFGCGEF--V-------------LSGKSVGTP---NTCINI--LKILNISLTGGtdFWDGQNKS-----G-----G 451  Vibrio medite...
WP_011966617  397 eQYVPFGCTEF--V-------------IQGQSTGTP---NICINL--LKLLTIYMNDGidPIDGKRKS-----G--PV-S 448  Parabacteroid...
Q2HBR9        772 rDYAADGCYEP--M-------------LAGASEFTF------NNVapLLALEQTLNEGstY---GEAGpeqlrGlkQTfR 827  Chaetomium gl...
Q8XZ58        928 hDYACDGCYEP--Q-------------FVGANWFHL----GGVTL--LQMLEVALNQGrqMQSAGPVDlfgknV--SF-R 983  Ralstonia sol...
EDO62661      363 tEYGVGGCLEI--G-------------IQGMNDDLLq--CAWVNM--PLMLELAITGGysLSERKQVDs----A--GI-P 416  [Clostridium]...
2YAJ_C        496 rAWCLGGCLESapGcflpleyngkvtmIPGGASPTCgtgVHFIGM--PKVLELVLTNGldKRTGKQVY-----P--PH-N 565  Clostridium s...
WP_005426151  387 rLYVAGGCQEI----------------CLSNEVNSRa--YTYLNL--VQMLNGSLYPEywNDIFKRDG-----F--EF-L 438  Blautia obeum
Q8A3J9        363 rRRIAVGCNWM--S-------------LPGLEYTMNd--LVKINM--AKVFEVSYTEMmnEQkd---------------- 407  Bacteroides t...
EDO60733      380 rRRIAVGCHWM--S-------------LPGLEYCLNd--CVKINS--AKVFEVALDEMmsQEgp---------------- 424  [Clostridium]...
2F3O_B        472 KP--K-----FLEDLLEKLREQVSHIVKLVVRGSNVLSYANAEVKPTPLLSLCVEDCFEKGVDVSRggaryn-ftgiqaV 543  Archaeoglobus...
WP_006069341  452 TSllQpeqvtSFDDVIKNYKDLLDFYIELTSKAQAFSYQVMNQEVGFLFTSILTDDCIGRSKALLDggvykl-ggtnetY 530  Vibrio medite...
WP_011966617  449 LK--KleeyqTFEEFYDGYKALLDYYLDLSVKAQYHSYEVMNQHVSFLFTSLLTDDCIARGKALLDggvryl-ggtnetY 525  Parabacteroid...
Q2HBR9        828 SK--PakefkSFEDLKDTFVKQLEWLVVQCYNTMLDGYGNLANVCPSPLLSVLIQGCVEKGRDLTNggskfh-imaplcV 904  Chaetomium gl...
Q8XZ58        984 SQ--PasaiaSYAELEEVFFKHLEWTFARQMEGTVADFGRMEGVCPSPLLNLFIHDCLAKGRDIYAggaryn-vfgpcfT 1060 Ralstonia sol...
EDO62661      417 LP--GlaqhnTFESFYKNYLDFTDRLVGISFSMIERQSIHDEKYRPAYLISSMIDDCLERGRHMHAggaryh-dysmtpL 493  [Clostridium]...
2YAJ_C        566 Kkl------dSYETMVNQWKEYMELTTDVVNRCNNIQMDIWRKYNMPAVNSLLKPDCFKKGKHIGTmgarynscinfesC 639  Clostridium s...
WP_005426151  439 PA--Ana--sDFEEFYHIVIENYRNELNFFVKKYNEYGSWWKIINPSLFFSATMPSCTETAKDVSEggavyn-tdnfaaA 513  Blautia obeum
Q8A3J9        408 ---------hSTSRLWMLFNEHLAKAVQTSADGIRHHLKFQKYNEPELLLNLLSHGPLEKGKDVSDggaeyy-nlaidgA 477  Bacteroides t...
EDO60733      425 ---------ySTERLWELYQKHMARAVEVTAEGVAFHLKYQQYNEPELMLNLISHGPVEKGLDMTCggamyy-nmcmdgA 494  [Clostridium]...
2F3O_B        544 GIADVGDSLVAIEGa----lNAGYSMDDiVEACRKNFVGYeklhk-------------------------lllqSPKYGN 594  Archaeoglobus...
WP_006069341  531 GNTNAYDSLAAIKKvi--feDKKYSYSElIQALRVNFDGYdrmky-------------------------dlinAPKFGN 583  Vibrio medite...
WP_011966617  526 GNINTSDSLWVIRDlv--fnQKKYTLRQlNDAMLANFNGYealrk-------------------------dclnCDKYGN 578  Parabacteroid...
Q2HBR9        905 GMSNTIDSLYAIQKlvfddeTARVTLQElVKCLICDWGHNmiepyenqlsgtadas---erglryselrnaalaLPKWGS 981  Chaetomium gl...
Q8XZ58       1061 SLANTINALWAIRVmcfdqaTAITTLSElVQALLCNWGENmidplvhptvlagdatrvsqaatrfrqlrsialsLPRWGR 1140 Ralstonia sol...
EDO62661      494 GIPNVIDGLYAIRTav--fdQHICTAEElVSAMRADFKGYerlqr-------------------------qlraIPKYGQ 546  [Clostridium]...
2YAJ_C        640 GTITFVNSLSSIKKnv--fdDSKFTIEEmTDAMLNNFGFKtayetevfspdfrest---dkstkyekifaacvnAPKYGN 714  Clostridium s...
WP_005426151  514 GAGTVIDSLYAIKKav--yeDKITTFGHlLKAMKEDFRDDeilrq------------------------yllhkVPKFCK 567  Blautia obeum
Q8A3J9        478 GLATVADSFAALEQri--elENKLSWNTlTEYLRNNFSGDggcrir-----------------------hllknSEKYGA 532  Bacteroides t...
EDO60733      495 AIATVADSFGALQQrv--eeEKRIDWQAlYHHLKTDFQDEggelvr-----------------------qmlshSPRYGG 549  [Clostridium]...
2F3O_B        595 DDDAADKYTKMVLEWYCE-EVNRHRN-F--RGGKFAAGCYPMTTNV-GFG 639  Archaeoglobus fulgidus
WP_006069341  584 DDAYVDDIAVEMHEYICN-------------GIKDSAAKVGMDSYL-VVI 619  Vibrio mediterranei
WP_011966617  579 DLETADTMANDLYEFVAKgVRDRGIA-I---GMQY---FLIVISNN-QLN 620  Parabacteroides distasonis
Q2HBR9        982 GDEEVNKLGDWLVQTCVDlCVKAIRH-P---NATIKAHLDNIKK---TYG 1024 Chaetomium globosum CBS 148.51
Q8XZ58       1141 GNADIDRFGNEICQRVAGiAVQVMAQpRdgLADQYRRKAMAYGTPAhPFG 1190 Ralstonia solanacearum
EDO62661      547 ENDDADDFARTVVTDIAKmFVTRRNR-F---GGIFRPMVLTF-IYA-PLA 590  [Clostridium] leptum DSM 753
2YAJ_C        715 ADKYADEIFKAYHYYIYD-MTHKFRS-Y--YGKPLYLCQISVSTHG-PQG 759  Clostridium scatologenes
WP_005426151  568 DKD-ATEFGKKVMDDLAE-CLGGQAN-Y--RGGKFEPSLFAFYSYN-WFK 611  Blautia obeum
Q8A3J9        533 AESLGEKWAIRIKETFTE-LVRLQSEpD--KRRIFIPGFFSWANTV-GFG 578  Bacteroides thetaiotaomicron
EDO60733      550 GNTISDQWAVRISNSYSE-QVRAVSEkY--PGCEFIPGWFSWSNTI-VLG 595  [Clostridium] leptum DSM 753
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap