2FLQ,5G67


Conserved Protein Domain Family
NO_synthase

?
pfam02898: NO_synthase 
Click on image for an interactive view with Cn3D
Nitric oxide synthase, oxygenase domain
Statistics
?
PSSM-Id: 397165
Aligned: 70 rows
Threshold Bit Score: 547.52
Threshold Setting Gi: 501850832
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2FLQ_A             12 HDEQLMTKAEQFIIASYRELGKsEQEIKRRVNEIRWEVEQTGTYRHTYEELSYGAKMAWRHSNRCIGRLFWQSLHVIDAR 91  Geobacillu...
WP_012574019        1 ---MLWKEAEQFITLCYTELGKsDNEIYKRLQQIQHEIEQTGTYEHTYEELEHGARMAWRNSNRCIGRLFWQTLHVFDAR 77  Anoxybacil...
jgi:B1NLA3E_08360   3 MNNELLIQAKEFITKCYSELGKsGEEIKLRIDEVEQQIQDESHYDHTYEELQHGSRMAWRNSNRCIGRLFWESLHIIDQR 82  Bacillus s...
5G67_A              3 EKEILWNEAKAFIAACYQELGK-AAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRR 81  Bacillus s...
WP_012009247        3 NQEALWNEAEAFISVCYEELGKsNEEKAARLHEIKQEINSKGTYTHTQEELAHGAKMAWRNSNRCIGRLFWSTLHVHDCR 82  Bacillus p...
Q65MJ4              3 SHEELWREAKAFIELCYGELSKsEEETRMRLHKIDKEIRETGSYTHTLEEIEHGARMAWRNSSRCIGRLFWHSLTVIDQR 82  Bacillus l...
WP_015893890        2 EPIQLMEAAEQFIRTCYRELDKtTDETEQRLQEVRQLINQQGYYEHTAEELRHGAKMAWRNSNRCIGRFFWESLVVIDER 81  Brevibacil...
Q9KEM9              3 EKERLQLEAESFLTKCYEELGSt-GELSKRLEEVRKEIDKTGTYVHTTKELAHGARMAWRNSNRCIGRLFWESLHVLDCR 81  Bacillus h...
Q5WIK0              1 MANRLEDEAVEFLSLFYEE--RcLDGKEARVRDVCEAIRTGGTYEHTAEELAFGARLAWRNSNRCIGRLFWERLTVIDER 78  Bacillus c...
jgi:Pjdr2_3338      2 IATELYKEAEQFIANCYSELGKtEIEALCRLKEIEQSIESKGHYVHTLEELRHGARMAWRNSNRCIGRLFWQSLEVVDAR 81  Paenibacil...
2FLQ_A             92 EAVTEEEVFSYLFHHIEVATNGGKIRPTITIFRP--NG--EVRIWNHQLIRYAGYE-TEEGIIGDSSSLTFTRACEQLGW 166 Geobacillu...
WP_012574019       78 AIEREEDIAEWLFHHIAFATNGGKIRPTITIFRSe-----RVRIWNHQLIRYAGYE-TEHGMIGDPSSISFTKACEHLGW 151 Anoxybacil...
jgi:B1NLA3E_08360  83 HLNTEEEISDALLQHIDYATNGGKIRPTITIFKPkmKDevQVRLWNHQIIRYAGYE-TENGVVGDPHSFDFTKMCQELGW 161 Bacillus s...
5G67_A             82 DVRTKEEVRDALFHHIETATNNGKIRPTITIFPPeeKGekQVEIWNHQLIRYAGYE-SDGERIGDPASCSLTAACEELGW 160 Bacillus s...
WP_012009247       83 HVKTEEEVKEALFHHIEYATNNGKIKPSITIFPPenDSqkEVIIYNHQLVRYAGYE-TEYGIIGDEASLELTKLCEAHGW 161 Bacillus p...
Q65MJ4             83 GVQTEAEVRDALFHHIQLATNGGKIRPFITVFPPeqNGqkKVSIWNHQLIRYAGYE-TEQGVIGDPASLELTKACEALGW 161 Bacillus l...
WP_015893890       82 HVETEEEMAQAMLRHIDFATNGGKIRPTITVFAPavAGraPMRIWNDQLIRYAGYE-TEYGVLGDPITLSLTKLCESLGW 160 Brevibacil...
Q9KEM9             82 HLQTEEEMAEALVDHITYATNDGKILPTISVFRPrhPNkgDVRIWNQQLIRYAGYEeGD-QVIGDPISTKFTQACERLGW 160 Bacillus h...
Q5WIK0             79 EARTEEAVAQALFRHIEYATNGGKVIPTITVFKQg----aSIRIWNAQLVRYAGYR-GDGRIIGDPASLELTDICKQLGW 153 Bacillus c...
jgi:Pjdr2_3338     82 SLQDSDQMAEQIFNHIKYATNEGRVRPTITVFAPqcGDr-QIRIWNHQLVRYAGYE-TESGILGDPASLDFTRVCTALGW 159 Paenibacil...
2FLQ_A            167 KGEKTPFDVLPLVIQVGGQk-PVWTPIPKELVLEVPIEHPEFPWFRDLQLKWYAVPIISDMCLEIGGIRYMAAPFNGWYM 245 Geobacillu...
WP_012574019      152 RGERTHFDILPLVIQVDGRe-PKLFPIPKHIVLEVPIEHPTFSWFRDLQLKWYAVPIISDMCLEIGGIRYTAAPFNGWYM 230 Anoxybacil...
jgi:B1NLA3E_08360 162 KGQGTDFDVLPMVIQVKENr-PKMFTIPHEKVLEVPLRHPEYEWFKDLNLKWYGVPMVAQLRLEIGGIHYTAAPFNGWYM 240 Bacillus s...
5G67_A            161 RGERTDFDLLPLIFRMKGDeqPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYM 240 Bacillus s...
WP_012009247      162 KGEGTHFDILPLMFQLKNQp-PVLYELPKEIVQEVEITHPEYEGFRDLGLKWYAVPIIADMKLEIGGIHYNAAPFNGWYM 240 Bacillus p...
Q65MJ4            162 KGEGTPFDVLPLVFQIDGRp-PVWYELPREIVKEVRIEHPEIEGFKSLGLKWYAVPIIADMKLEVGGIHYNAAPFNGWYM 240 Bacillus l...
WP_015893890      161 QGKGTNYDVLPLVVQIGDRt-PQFFEIPQELVLEVPIVHPDLPGFADMELKWYGVPIVSNMRMEIGGIDYLAAPFNGWYM 239 Brevibacil...
Q9KEM9            161 SGERTPFDVLPLVIQDGSKp-PKWFAVPNESVKEVPLRHPEYEWFAGFQLKWYAVPIVSNMRLEIGGIHYPAAPFNGWYM 239 Bacillus h...
Q5WIK0            154 VGAGGDFDVLPLVISVGARp-PQLFPIPEHLIKEVALVHPDNEAFARLNLKWYAVPFISNMRLEIGGISYYTAPFNGWYM 232 Bacillus c...
jgi:Pjdr2_3338    160 KGSGTAFDVLPIVIQVNNDp-PSWYELPEGLAKEVPLSHPEIERFEELALQWYAVPFISDMKLEIGGIAYTAAPFNGWYM 238 Paenibacil...
2FLQ_A            246 GTEIGARNFADDYRYNMLPKVASCMGLDTNSNASLWKDKALVELNIAVLYSYKKAGVSIVDHHTAARQFQLFEQQEKAAG 325 Geobacillu...
WP_012574019      231 GTEIGARNFADDYRYNMLPKIASCMGLDTSKNSTLWKDQALVELNIAVLYSYKKAGVSIVDHHTAAQQFKRFEQQEQEVG 310 Anoxybacil...
jgi:B1NLA3E_08360 241 ETEIGARNFADKDRYDLLPKVASMMGLDIESNTSLWQDRAILELNQAILYSYKEDGVSIVDHHTAAQQFKMFEEKEVSCG 320 Bacillus s...
5G67_A            241 GTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAG 320 Bacillus s...
WP_012009247      241 GTEIGARNLADENRYNMLKKVASILGLDTTKNASLWKDKAIVELNVAVLHSYREAGVTIVDHHTAAHQFKQFEKQEEKAD 320 Bacillus p...
Q65MJ4            241 GTEIGARNLADADRYNALEKVAAIMGLDTERNTSLWKDKALVELNTAVLHSYKKAGVSIVDHHTAASQFKRFEEQEAEAG 320 Bacillus l...
WP_015893890      240 GTEIGARNFADQERYNMLPKVAEVIGLDTSREVTLWRDKALIELNVAVLHSFKEKGVSIVDHHTASQQFKRFEEREEKCG 319 Brevibacil...
Q9KEM9            240 GTEIGARNLADEDRYNILPKMAEYMGLSTGKDSTLWKDKALVELNVAILYSYKQEGVSIVDHHTAAKQFARFEQAEQAAN 319 Bacillus h...
Q5WIK0            233 GTEIGARNLADDFRYNRLPEVAAVLGISMEREASLWRDQALVELNRAVLYSYQEQGVSIVDHHTAAKQFQRFIGNETEAG 312 Bacillus c...
jgi:Pjdr2_3338    239 GTEIGARNLADFNRYNKLPEVARLMGLDMSTNTSLWKDRALVELNVAVIHSFKKHGVSIVDHHTAAEQFMRFAQQEQNNG 318 Paenibacil...
2FLQ_A            326 RHVTGDWTWLIPPLSPATTHIFHRSYDNTMMLPNFFYQDRPYE 368 Geobacillus stearothermophilus
WP_012574019      311 RKVTGSWTWLIPPLSPATTHIFHQYYDNTIVKPNYFYQQRPYE 353 Anoxybacillus flavithermus
jgi:B1NLA3E_08360 321 RKVTGNWVWLVPPVSPATTHIFHKPYKNEMLKPNFFYQPNLFI 363 Bacillus sp. 1NLA3E
5G67_A            321 RKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE 363 Bacillus subtilis subsp. subtilis str. 168
WP_012009247      321 RKLTGDWTWLIPPVSPAATHIFHKHYDNTIVKPNYFYQEKPYH 363 Bacillus pumilus
Q65MJ4            321 RELAASWTWLIPPLSPAATHIFHSYYENKTLKPNYFYQEKPYL 363 Bacillus licheniformis DSM 13 = ATCC 14580
WP_015893890      320 RPVTGDWTWLVPPISGTASHIFHSLYDNTIHTPNFFYQDKPEL 362 Brevibacillus brevis
Q9KEM9            320 RKVTGRWSWLIPPVSPATTHIFHHEYEDETVLPNYFYQPAPYE 362 Bacillus halodurans
Q5WIK0            313 RDVTGDWTWLIPPMSPAQTDIFHQSFDNRIVSPNYFHEKPPYC 355 Bacillus clausii KSM-K16
jgi:Pjdr2_3338    319 RPLTGRWSWLIPPMSPSTTPVWHRGFDNSELKPAYSYQKAPYI 361 Paenibacillus sp. JDR-2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap