3OLP


Conserved Protein Domain Family
PGM_PMM_II

?
pfam02879: PGM_PMM_II 
Click on image for an interactive view with Cn3D
Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
Statistics
?
PSSM-Id: 397147
Aligned: 59 rows
Threshold Bit Score: 49.2069
Threshold Setting Gi: 123589786
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3OLP_A       234 PFVEGLADIVdm--aaIQKA---GLTLGVDPLGGSGIEYWKRIAEHYKL-----NLt-lVNDQVDQTFRFmhldkdGAIR 302 Salmonella ente...
B0T1V6       161 RYIEIVKATFpr---nMSLA---GLRIVIDCAHGAAYKVAPQALYELGA-----EVf-pVGVAPNGTNINae---cGSTH 225 Caulobacter sp....
Q74K59       161 KYLQFIENTLp-----EELS---GIKVVVDGANGAASALISRLFADMGV-----DFt-tIATHPDGLNIN---------D 217 Lactobacillus j...
Q5P7R1       179 AYLDRVTADVk------LAR---PMKIVIDCGNGVAGAVAPQLFRRLGC-----ELv-eLFCDVDGTFPN------HHPD 237 Aromatoleum aro...
Q6FDQ9       161 VYQDTILQDI------HLNR---SFKVVLDGLHGSAGQCAKILLEKLGC-----DVi-aLRCEANGEFPD------HAPD 219 Acinetobacter b...
WP_011697354 150 PYIDYVLQSVrp------kR---SLRIGLDAGNATGGPVALPLLRDLGC-----RVy-pLYCEMDGTFPN------HEPD 208 Syntrophobacter...
Q6LXH9       147 EYLNFFTQKLe-----KTNR-----KIAVDFANGATTNAEKQVLKKVLE-----NKi-fVNDFPDGNFPA------HEPD 204 Methanococcus m...
Q06951       157 EYVDHLISYItp--akIKPM-----KLVINSGNGAAGHVIDELEKRFIElsiplEIi-kVHHEEDGNFPN------GIPN 222 Vibrio cholerae...
Q837Z6       167 IYAEHLVEKIrqgihsPEEKplqGFRIIVDAGNGAGGFFAEQVLQVLGA-----DTtgsQFLEPDGHFPN------HVPN 235 Enterococcus fa...
O86374       159 DYGAFLRSLVd----tSGLR---PLRVAVDAGNGMAGHTAPAVLGVIDSi----TLl-pSYFELDGSFPN------HEAN 220 Mycobacterium t...
3OLP_A       303 MDCSSECAMAGLLALRDKFDLAFANDPDYDRHGIVTPAG 341 Salmonella enterica subsp. enterica serovar Typhimurium
B0T1V6       226 PEA------MARLVREYRADIGIALDGDADRLVICDEKG 258 Caulobacter sp. K31
Q74K59       218 HVGATHTKKLQEEVVKQGAQLGLAFDGDADRCIAVDENG 256 Lactobacillus johnsonii NCC 533
Q5P7R1       238 PSKPENLQDVIRALRDTDAELGLAFDGDGDRLGIVTKAG 276 Aromatoleum aromaticum EbN1
Q6FDQ9       220 PSQAKHLESLRQQIILQRADIGIALDGDGDRLVVIDEHT 258 Acinetobacter baylyi
WP_011697354 209 PTVMENMRDIQELVVKENLDVGIALDGDCDRLGVIDHRG 247 Syntrophobacter fumaroxidans
Q6LXH9       205 TLKKECLIDIINSVKSNSCEFGLIFDGDGDRIGMVDEKG 243 Methanococcus maripaludis
Q06951       223 PLLPECRADTANAVKEHKADMGIAFDGDFDRCFLFDENG 261 Vibrio cholerae O1 biovar El Tor str. N16961
Q837Z6       236 PDNSEAMKSIQTAVLANQADLGIIFDTDVDRSAVVDQSG 274 Enterococcus faecalis
O86374       221 PLDPANLVDLQAYVRDTGADIGLAFDGDADRCFVVDERG 259 Mycobacterium tuberculosis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap