6CP3,1MAB,2R9V,5GAR,5KND,5KNC,6O7X


Conserved Protein Domain Family
ATP-synt_ab_N

?
pfam02874: ATP-synt_ab_N 
Click on image for an interactive view with Cn3D
ATP synthase alpha/beta family, beta-barrel domain
This family includes the ATP synthase alpha and beta subunits the ATP synthase associated with flagella.
Statistics
?
PSSM-Id: 397142
Aligned: 124 rows
Threshold Bit Score: 38.6712
Threshold Setting Gi: 239977230
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6CP3_E  13 VTAVIGAIVDVHFEQSELPAILNALEIK-TPQGKLV-L-EVAQHLGENTVRTIAMDGTEGLVRGEKVLDTG 80  Saccharomyces cerevisiae S288C
Q8PB87  28 VVEVIGTMLKV-AGVQVSLGEVCELRQR--D-GTLLqR-AEVVGFSRTLALLAPFGELVGLSRQTRVIGLG 93  Xanthomonas campestris pv. cam...
Q8XRH7  26 VVEVTGTLLRV-GGVDVRLGELCTLTEA--D-GTVM-QeGEVVGFSEHFALVAPFSGVTGLSRSTRVVPSG 91  Ralstonia solanacearum
Q326Q8  13 pnKISGPILET-SLSDVSIGEICNIQAGiESNEIVA-R-AQVVGFHDEKTILSLIGNSRGLSRQTLIKPTa 80  Shigella dysenteriae Sd197
Q7ARI8  27 VTQVTGTLLKA-VVPGVRIGELCYLRNP--DNSLSL-Q-AEVIGFAQHQALLIPLGEMYGISSNTEVSPTG 92  Yersinia pestis
Q5ZUN6  30 ISRAIGLTIEAKGFNQ-PVGARCLVKIN--D-EHSV-Q-AEVVGFSNESVYLMSIGDIQGIAPGMKIIPTG 94  Legionella pneumophila subsp. ...
P52607  24 VQKIKGLLVES-LGPQCAIGDLCLIDQR--N-GKKV-C-AEVLGFNGPYVSLMAYEGFSGIEVGNKVYSLN 88  Borreliella burgdorferi B31
O84722  23 LSRISGSLLEA-QGLSACLGELCQISLS--R-SDPI-L-AEVIGIHNRTTLLLALTPIYYLAIGAEVVPLR 87  Chlamydia trachomatis
O83417  25 VTAVRGLLIES-RGPHAVVGELCRIVLR--RQGRPL-I-AEVVGLAGSTVKLMSYTDTHGVEVGCAVVAEG 90  Treponema pallidum subsp. pall...
Q9WY61  24 VTRVVGLTVES-KGPDAFLGEMCKISLQ--N-GKNA-L-AEVVGFREESVILMPYEDVSGLKMGCEVIRTN 88  Thermotoga maritima
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap